BLASTX nr result
ID: Chrysanthemum22_contig00039715
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039715 (545 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011088006.1| K(+) efflux antiporter 3, chloroplastic [Ses... 57 3e-06 gb|EYU18371.1| hypothetical protein MIMGU_mgv1a001684mg [Erythra... 57 5e-06 ref|XP_012828317.1| PREDICTED: K(+) efflux antiporter 3, chlorop... 57 5e-06 ref|XP_021977708.1| K(+) efflux antiporter 3, chloroplastic [Hel... 56 6e-06 >ref|XP_011088006.1| K(+) efflux antiporter 3, chloroplastic [Sesamum indicum] Length = 806 Score = 57.4 bits (137), Expect = 3e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 340 GLKTRLQVLANFLSTPLASWIDGKAGWPFVAFYLDASMV 224 G + Q+LANFLSTPLAS IDG AGWP+VAF LD S+V Sbjct: 544 GFGQKAQILANFLSTPLASGIDGDAGWPYVAFDLDPSVV 582 >gb|EYU18371.1| hypothetical protein MIMGU_mgv1a001684mg [Erythranthe guttata] Length = 773 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 340 GLKTRLQVLANFLSTPLASWIDGKAGWPFVAFYLDASMV 224 G + QVLANFLSTPLAS IDG +GWP+VAF LD S+V Sbjct: 531 GFGQKAQVLANFLSTPLASGIDGDSGWPYVAFDLDLSVV 569 >ref|XP_012828317.1| PREDICTED: K(+) efflux antiporter 3, chloroplastic [Erythranthe guttata] Length = 787 Score = 56.6 bits (135), Expect = 5e-06 Identities = 27/39 (69%), Positives = 31/39 (79%) Frame = -2 Query: 340 GLKTRLQVLANFLSTPLASWIDGKAGWPFVAFYLDASMV 224 G + QVLANFLSTPLAS IDG +GWP+VAF LD S+V Sbjct: 545 GFGQKAQVLANFLSTPLASGIDGDSGWPYVAFDLDLSVV 583 >ref|XP_021977708.1| K(+) efflux antiporter 3, chloroplastic [Helianthus annuus] gb|OTG18809.1| putative K+ efflux antiporter 3 [Helianthus annuus] Length = 765 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 322 QVLANFLSTPLASWIDGKAGWPFVAFYLDASMV 224 QVLANFLSTPLA+ IDG AGWPFVAF LD S+V Sbjct: 526 QVLANFLSTPLANGIDGDAGWPFVAFDLDPSVV 558