BLASTX nr result
ID: Chrysanthemum22_contig00039684
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039684 (556 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021993743.1| stress-related protein-like isoform X3 [Heli... 59 4e-07 ref|XP_021993742.1| stress-related protein-like isoform X2 [Heli... 59 4e-07 ref|XP_021993741.1| stress-related protein-like isoform X1 [Heli... 59 4e-07 ref|XP_022035346.1| stress-related protein-like [Helianthus annu... 58 6e-07 gb|AMB19721.1| small rubber particle protein 1 [Taraxacum kok-sa... 56 3e-06 ref|XP_015067921.1| PREDICTED: stress-related protein-like [Sola... 56 4e-06 ref|XP_009776924.1| PREDICTED: REF/SRPP-like protein At3g05500 [... 56 4e-06 ref|XP_009626020.1| PREDICTED: REF/SRPP-like protein At3g05500 [... 56 4e-06 ref|XP_006344668.1| PREDICTED: stress-related protein [Solanum t... 56 4e-06 ref|XP_015062915.1| PREDICTED: stress-related protein [Solanum p... 56 4e-06 gb|PHT98952.1| Stress-related protein [Capsicum chinense] 56 4e-06 gb|PHT41397.1| Stress-related protein [Capsicum baccatum] 56 4e-06 ref|NP_001311500.1| REF/SRPP-like protein At3g05500 [Capsicum an... 56 4e-06 gb|ADI60300.1| stress-related protein 1 [Capsicum annuum] >gi|12... 56 4e-06 ref|XP_018855378.1| PREDICTED: stress-related protein-like, part... 53 5e-06 gb|KVG61100.1| Rubber elongation factor [Cynara cardunculus var.... 55 5e-06 ref|XP_023736602.1| REF/SRPP-like protein At3g05500 [Lactuca sat... 55 7e-06 gb|AJC97799.1| small rubber particle protein [Lactuca sativa] 55 7e-06 gb|PKI51504.1| hypothetical protein CRG98_028064 [Punica granatum] 55 8e-06 gb|OWM62926.1| hypothetical protein CDL15_Pgr020220 [Punica gran... 55 9e-06 >ref|XP_021993743.1| stress-related protein-like isoform X3 [Helianthus annuus] Length = 209 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAYDKFHDVPVEVLKFVDRKV Sbjct: 63 LKTVVGPAYDKFHDVPVEVLKFVDRKV 89 >ref|XP_021993742.1| stress-related protein-like isoform X2 [Helianthus annuus] gb|OTG08224.1| putative REF/SRPP-like protein [Helianthus annuus] Length = 210 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAYDKFHDVPVEVLKFVDRKV Sbjct: 64 LKTVVGPAYDKFHDVPVEVLKFVDRKV 90 >ref|XP_021993741.1| stress-related protein-like isoform X1 [Helianthus annuus] Length = 217 Score = 58.5 bits (140), Expect = 4e-07 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAYDKFHDVPVEVLKFVDRKV Sbjct: 71 LKTVVGPAYDKFHDVPVEVLKFVDRKV 97 >ref|XP_022035346.1| stress-related protein-like [Helianthus annuus] gb|OTG28957.1| putative small rubber particle protein [Helianthus annuus] Length = 216 Score = 58.2 bits (139), Expect = 6e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAYDKFHD+PVEVLKFVDRKV Sbjct: 63 LKTVVGPAYDKFHDIPVEVLKFVDRKV 89 >gb|AMB19721.1| small rubber particle protein 1 [Taraxacum kok-saghyz] Length = 231 Score = 56.2 bits (134), Expect = 3e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAYDKF+DVPVEVLKFVDRKV Sbjct: 63 LKTVVGPAYDKFYDVPVEVLKFVDRKV 89 >ref|XP_015067921.1| PREDICTED: stress-related protein-like [Solanum pennellii] Length = 214 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 51 VKTVVGPVYDKFHDVPVEVLKFVDRKV 77 >ref|XP_009776924.1| PREDICTED: REF/SRPP-like protein At3g05500 [Nicotiana sylvestris] ref|XP_016510231.1| PREDICTED: REF/SRPP-like protein At3g05500 [Nicotiana tabacum] Length = 226 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 63 VKTVVGPVYDKFHDVPVEVLKFVDRKV 89 >ref|XP_009626020.1| PREDICTED: REF/SRPP-like protein At3g05500 [Nicotiana tomentosiformis] ref|XP_016451658.1| PREDICTED: REF/SRPP-like protein At3g05500 [Nicotiana tabacum] Length = 226 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 63 VKTVVGPVYDKFHDVPVEVLKFVDRKV 89 >ref|XP_006344668.1| PREDICTED: stress-related protein [Solanum tuberosum] Length = 226 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 63 VKTVVGPVYDKFHDVPVEVLKFVDRKV 89 >ref|XP_015062915.1| PREDICTED: stress-related protein [Solanum pennellii] Length = 227 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 64 VKTVVGPVYDKFHDVPVEVLKFVDRKV 90 >gb|PHT98952.1| Stress-related protein [Capsicum chinense] Length = 228 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 65 VKTVVGPVYDKFHDVPVEVLKFVDRKV 91 >gb|PHT41397.1| Stress-related protein [Capsicum baccatum] Length = 228 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 65 VKTVVGPVYDKFHDVPVEVLKFVDRKV 91 >ref|NP_001311500.1| REF/SRPP-like protein At3g05500 [Capsicum annuum] gb|AHI85706.1| stress-induced protein 1 [Capsicum annuum] Length = 228 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 65 VKTVVGPVYDKFHDVPVEVLKFVDRKV 91 >gb|ADI60300.1| stress-related protein 1 [Capsicum annuum] gb|PHT62037.1| Stress-related protein [Capsicum annuum] Length = 228 Score = 55.8 bits (133), Expect = 4e-06 Identities = 25/27 (92%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVPVEVLKFVDRKV Sbjct: 65 VKTVVGPVYDKFHDVPVEVLKFVDRKV 91 >ref|XP_018855378.1| PREDICTED: stress-related protein-like, partial [Juglans regia] Length = 92 Score = 53.1 bits (126), Expect = 5e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +K+VVGP YDKFHDVPVEVLK+VDRKV Sbjct: 63 VKSVVGPVYDKFHDVPVEVLKYVDRKV 89 >gb|KVG61100.1| Rubber elongation factor [Cynara cardunculus var. scolymus] Length = 222 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/37 (72%), Positives = 30/37 (81%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKVCFFAHPLSSM 111 LKTVVGPAYDK HDVPVEVLKFVD+KV LS++ Sbjct: 64 LKTVVGPAYDKLHDVPVEVLKFVDQKVSTKTKSLSTV 100 >ref|XP_023736602.1| REF/SRPP-like protein At3g05500 [Lactuca sativa] gb|PLY71632.1| hypothetical protein LSAT_9X87820 [Lactuca sativa] Length = 212 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAY KFHDVPVEVLKFVDRKV Sbjct: 63 LKTVVGPAYVKFHDVPVEVLKFVDRKV 89 >gb|AJC97799.1| small rubber particle protein [Lactuca sativa] Length = 212 Score = 55.1 bits (131), Expect = 7e-06 Identities = 26/27 (96%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 LKTVVGPAY KFHDVPVEVLKFVDRKV Sbjct: 63 LKTVVGPAYVKFHDVPVEVLKFVDRKV 89 >gb|PKI51504.1| hypothetical protein CRG98_028064 [Punica granatum] Length = 234 Score = 55.1 bits (131), Expect = 8e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVP+EVLKFVDRK+ Sbjct: 53 VKTVVGPVYDKFHDVPIEVLKFVDRKI 79 >gb|OWM62926.1| hypothetical protein CDL15_Pgr020220 [Punica granatum] Length = 240 Score = 55.1 bits (131), Expect = 9e-06 Identities = 23/27 (85%), Positives = 26/27 (96%) Frame = +1 Query: 1 LKTVVGPAYDKFHDVPVEVLKFVDRKV 81 +KTVVGP YDKFHDVP+EVLKFVDRK+ Sbjct: 59 VKTVVGPVYDKFHDVPIEVLKFVDRKI 85