BLASTX nr result
ID: Chrysanthemum22_contig00039601
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039601 (484 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY81315.1| hypothetical protein LSAT_4X25260 [Lactuca sativa] 59 2e-08 gb|PLY65864.1| hypothetical protein LSAT_4X57040 [Lactuca sativa] 57 3e-08 gb|PLY83681.1| hypothetical protein LSAT_4X26020 [Lactuca sativa] 57 6e-08 gb|PLY62356.1| hypothetical protein LSAT_8X76981 [Lactuca sativa... 57 6e-08 gb|PLY98751.1| hypothetical protein LSAT_1X7320 [Lactuca sativa] 57 6e-08 gb|PLY67718.1| hypothetical protein LSAT_4X701 [Lactuca sativa] 57 8e-08 gb|PLY70069.1| hypothetical protein LSAT_8X76301 [Lactuca sativa] 54 9e-07 gb|PLY64129.1| hypothetical protein LSAT_1X1101 [Lactuca sativa] 54 9e-07 ref|XP_023762125.1| uncharacterized protein LOC111910520 [Lactuc... 53 8e-06 >gb|PLY81315.1| hypothetical protein LSAT_4X25260 [Lactuca sativa] Length = 89 Score = 58.5 bits (140), Expect = 2e-08 Identities = 24/34 (70%), Positives = 26/34 (76%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI+WVDP MC R Sbjct: 15 SWTPKNPGRRFYACPQKDSACRFIEWVDPPMCER 48 >gb|PLY65864.1| hypothetical protein LSAT_4X57040 [Lactuca sativa] Length = 61 Score = 57.4 bits (137), Expect = 3e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTPKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >gb|PLY83681.1| hypothetical protein LSAT_4X26020 [Lactuca sativa] Length = 84 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTPKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >gb|PLY62356.1| hypothetical protein LSAT_8X76981 [Lactuca sativa] gb|PLY79239.1| hypothetical protein LSAT_9X111881 [Lactuca sativa] gb|PLY81961.1| hypothetical protein LSAT_9X96521 [Lactuca sativa] gb|PLY86163.1| hypothetical protein LSAT_6X94861 [Lactuca sativa] gb|PLY90437.1| hypothetical protein LSAT_0X40601 [Lactuca sativa] gb|PLY90942.1| hypothetical protein LSAT_9X105340 [Lactuca sativa] Length = 84 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTPKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >gb|PLY98751.1| hypothetical protein LSAT_1X7320 [Lactuca sativa] Length = 89 Score = 57.4 bits (137), Expect = 6e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTPKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >gb|PLY67718.1| hypothetical protein LSAT_4X701 [Lactuca sativa] Length = 84 Score = 57.0 bits (136), Expect = 8e-08 Identities = 24/34 (70%), Positives = 25/34 (73%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWTP+NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTPKNPDRRFYAFPQKDSACRFIGWVDPPMCER 48 >gb|PLY70069.1| hypothetical protein LSAT_8X76301 [Lactuca sativa] Length = 84 Score = 54.3 bits (129), Expect = 9e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWT +NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTSKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >gb|PLY64129.1| hypothetical protein LSAT_1X1101 [Lactuca sativa] Length = 84 Score = 54.3 bits (129), Expect = 9e-07 Identities = 23/34 (67%), Positives = 24/34 (70%) Frame = +1 Query: 124 SWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 SWT +NP RFYA P DS CRFI WVDP MC R Sbjct: 15 SWTSKNPGRRFYACPQKDSACRFIGWVDPPMCER 48 >ref|XP_023762125.1| uncharacterized protein LOC111910520 [Lactuca sativa] Length = 126 Score = 52.8 bits (125), Expect = 8e-06 Identities = 23/35 (65%), Positives = 24/35 (68%) Frame = +1 Query: 121 SSWTPRNPCNRFYASPDLDSKCRFIDWVDPLMC*R 225 +SWTP NP RFYA P DS C FI WVDP MC R Sbjct: 14 TSWTPLNPGRRFYACPTKDSVCGFIGWVDPPMCAR 48