BLASTX nr result
ID: Chrysanthemum22_contig00039527
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039527 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OVA01198.1| Cytochrome c oxidase [Macleaya cordata] 61 2e-18 gb|KVH88630.1| hypothetical protein Ccrd_026265 [Cynara carduncu... 60 1e-07 >gb|OVA01198.1| Cytochrome c oxidase [Macleaya cordata] Length = 509 Score = 61.2 bits (147), Expect(2) = 2e-18 Identities = 37/63 (58%), Positives = 38/63 (60%) Frame = -2 Query: 427 IMLIHVLHGQGSIGF*SHYDLVVQKRFFLDQNSGMEGTTIKV*SFSNRSAKTDVQKGSRD 248 IMLIHV HGQGSI NSGMEGTT K+ SFSN AK DVQKGSRD Sbjct: 145 IMLIHVPHGQGSI------------------NSGMEGTTRKIYSFSNSPAKMDVQKGSRD 186 Query: 247 SQS 239 QS Sbjct: 187 YQS 189 Score = 58.9 bits (141), Expect(2) = 2e-18 Identities = 34/58 (58%), Positives = 38/58 (65%) Frame = -1 Query: 209 GRERDQAEPLVE*ALPTCQNELQPQPERSTCAFDVRPRRKVFRNRTEWNCYFPKMLSE 36 GRERD+AEPL E P QNEL +R R+ VFRNRTEWNCYFPKML+E Sbjct: 194 GRERDKAEPLGE--PPAAQNEL------------IRDRQ-VFRNRTEWNCYFPKMLAE 236 >gb|KVH88630.1| hypothetical protein Ccrd_026265 [Cynara cardunculus var. scolymus] Length = 976 Score = 59.7 bits (143), Expect = 1e-07 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 354 RDSFSIRIVEWKALQ*RYSPFQIAPRRQTFRKVL 253 RDSFSIRIVEWKALQ RY PFQI RRQTFRKV+ Sbjct: 533 RDSFSIRIVEWKALQERYIPFQITLRRQTFRKVI 566