BLASTX nr result
ID: Chrysanthemum22_contig00039197
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039197 (1278 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020226951.1| probable receptor-like serine/threonine-prot... 63 4e-07 emb|CAT79815.1| Rop-interacting receptor-like cytoplasmic kinase... 62 7e-07 emb|CDP17510.1| unnamed protein product [Coffea canephora] 58 7e-07 ref|XP_003610091.1| tyrosine kinase family protein [Medicago tru... 62 9e-07 gb|KRH02853.1| hypothetical protein GLYMA_17G062300 [Glycine max] 62 1e-06 ref|XP_019439351.1| PREDICTED: probable receptor-like serine/thr... 62 1e-06 ref|NP_001238599.1| protein kinase family protein [Glycine max] ... 62 1e-06 ref|XP_022037867.1| probable receptor-like serine/threonine-prot... 62 1e-06 gb|KRH02852.1| hypothetical protein GLYMA_17G062300 [Glycine max] 61 1e-06 ref|XP_004507866.1| PREDICTED: probable receptor-like serine/thr... 61 2e-06 ref|XP_019442376.1| PREDICTED: probable receptor-like serine/thr... 61 2e-06 ref|XP_015881394.1| PREDICTED: probable receptor-like serine/thr... 61 2e-06 dbj|GAY37174.1| hypothetical protein CUMW_027020 [Citrus unshiu] 60 2e-06 ref|XP_010247702.1| PREDICTED: probable receptor-like serine/thr... 60 3e-06 ref|XP_020201938.1| probable receptor-like serine/threonine-prot... 60 4e-06 gb|PNT32084.1| hypothetical protein POPTR_006G166600v3 [Populus ... 60 4e-06 dbj|GAU35221.1| hypothetical protein TSUD_204970, partial [Trifo... 59 4e-06 gb|KDO43854.1| hypothetical protein CISIN_1g016594mg [Citrus sin... 60 5e-06 ref|XP_006453346.1| probable receptor-like serine/threonine-prot... 60 5e-06 gb|PNY16873.1| putative receptor-like serine threonine-protein k... 59 5e-06 >ref|XP_020226951.1| probable receptor-like serine/threonine-protein kinase At5g57670 [Cajanus cajan] gb|KYP57478.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 [Cajanus cajan] Length = 374 Score = 63.2 bits (152), Expect = 4e-07 Identities = 28/32 (87%), Positives = 31/32 (96%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R+AFAASLCIRASSTWRPTMSEV Sbjct: 291 GAYDVTQLKRIAFAASLCIRASSTWRPTMSEV 322 >emb|CAT79815.1| Rop-interacting receptor-like cytoplasmic kinase 1 [Medicago truncatula] Length = 381 Score = 62.4 bits (150), Expect = 7e-07 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 GEYDITQL+R+AFAASLCIRASSTWRP+M+EV Sbjct: 298 GEYDITQLKRLAFAASLCIRASSTWRPSMTEV 329 >emb|CDP17510.1| unnamed protein product [Coffea canephora] Length = 114 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/52 (53%), Positives = 36/52 (69%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEVCIFIHFIISNGVCSIQIIYV 156 G YD+ QL R+AFAASLCIR SS WRPTMSEV +F + + S++I + Sbjct: 58 GFYDVKQLNRLAFAASLCIRGSSIWRPTMSEVLLFPFNYYNYCIISLRIFLI 109 >ref|XP_003610091.1| tyrosine kinase family protein [Medicago truncatula] gb|AES92288.1| tyrosine kinase family protein [Medicago truncatula] Length = 381 Score = 62.0 bits (149), Expect = 9e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 GEYD+TQL+R+AFAASLCIRASSTWRP+M+EV Sbjct: 298 GEYDVTQLKRLAFAASLCIRASSTWRPSMTEV 329 >gb|KRH02853.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 329 Score = 61.6 bits (148), Expect = 1e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R AFAASLCIRASSTWRPTMSEV Sbjct: 297 GAYDVTQLKRFAFAASLCIRASSTWRPTMSEV 328 >ref|XP_019439351.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Lupinus angustifolius] gb|OIW14245.1| hypothetical protein TanjilG_21385 [Lupinus angustifolius] Length = 373 Score = 61.6 bits (148), Expect = 1e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQ RR+AFAASLCIRASSTWRPTMSEV Sbjct: 290 GAYDLTQFRRLAFAASLCIRASSTWRPTMSEV 321 >ref|NP_001238599.1| protein kinase family protein [Glycine max] gb|ACM89495.1| protein kinase family protein [Glycine max] gb|KHN17604.1| Putative receptor-like serine/threonine-protein kinase [Glycine soja] gb|KRH02851.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 380 Score = 61.6 bits (148), Expect = 1e-06 Identities = 28/32 (87%), Positives = 30/32 (93%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R AFAASLCIRASSTWRPTMSEV Sbjct: 297 GAYDVTQLKRFAFAASLCIRASSTWRPTMSEV 328 >ref|XP_022037867.1| probable receptor-like serine/threonine-protein kinase At5g57670 [Helianthus annuus] gb|OTG24916.1| putative protein kinase superfamily protein [Helianthus annuus] Length = 382 Score = 61.6 bits (148), Expect = 1e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 GEYD++QL R+AFAASLCIRASSTWRPTMSE+ Sbjct: 295 GEYDLSQLNRLAFAASLCIRASSTWRPTMSEI 326 >gb|KRH02852.1| hypothetical protein GLYMA_17G062300 [Glycine max] Length = 333 Score = 61.2 bits (147), Expect = 1e-06 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEVCIFIH 111 G YD+TQL+R AFAASLCIRASSTWRPTMSE I ++ Sbjct: 297 GAYDVTQLKRFAFAASLCIRASSTWRPTMSEEIISVN 333 >ref|XP_004507866.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Cicer arietinum] Length = 380 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R+AFAASLCIRASSTWRPTM+EV Sbjct: 297 GAYDVTQLKRLAFAASLCIRASSTWRPTMTEV 328 >ref|XP_019442376.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Lupinus angustifolius] gb|OIW19417.1| hypothetical protein TanjilG_09437 [Lupinus angustifolius] Length = 384 Score = 61.2 bits (147), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G+YD+TQL+R+AFAASLCIRASSTWRP MSEV Sbjct: 301 GDYDVTQLKRLAFAASLCIRASSTWRPIMSEV 332 >ref|XP_015881394.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Ziziphus jujuba] Length = 393 Score = 60.8 bits (146), Expect = 2e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R+AFAASLCIRASSTWRPTMS+V Sbjct: 300 GAYDVTQLKRLAFAASLCIRASSTWRPTMSKV 331 >dbj|GAY37174.1| hypothetical protein CUMW_027020 [Citrus unshiu] Length = 257 Score = 59.7 bits (143), Expect = 2e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL R+AFAASLCIRAS TWRPTMSEV Sbjct: 171 GAYDVTQLNRLAFAASLCIRASPTWRPTMSEV 202 >ref|XP_010247702.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Nelumbo nucifera] Length = 384 Score = 60.5 bits (145), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 GEYD+TQL+R+ F ASLCIRAS+TWRPTMSEV Sbjct: 300 GEYDVTQLKRLTFTASLCIRASATWRPTMSEV 331 >ref|XP_020201938.1| probable receptor-like serine/threonine-protein kinase At5g57670 [Cajanus cajan] gb|KYP40785.1| hypothetical protein KK1_037863 [Cajanus cajan] Length = 371 Score = 60.1 bits (144), Expect = 4e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQ R+AFAASLCIRASSTWRPTMSEV Sbjct: 289 GAYDVTQFNRLAFAASLCIRASSTWRPTMSEV 320 >gb|PNT32084.1| hypothetical protein POPTR_006G166600v3 [Populus trichocarpa] Length = 386 Score = 60.1 bits (144), Expect = 4e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL+R+ FAASLCIRASSTWRPTMSEV Sbjct: 297 GIYDVTQLKRLGFAASLCIRASSTWRPTMSEV 328 >dbj|GAU35221.1| hypothetical protein TSUD_204970, partial [Trifolium subterraneum] Length = 261 Score = 58.9 bits (141), Expect = 4e-06 Identities = 28/37 (75%), Positives = 30/37 (81%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEVCIFIH 111 G YD+TQL R AFAASLCIRASSTWRPTM+E IH Sbjct: 218 GAYDVTQLMRFAFAASLCIRASSTWRPTMTEKKQVIH 254 >gb|KDO43854.1| hypothetical protein CISIN_1g016594mg [Citrus sinensis] Length = 386 Score = 59.7 bits (143), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL R+AFAASLCIRAS TWRPTMSEV Sbjct: 300 GAYDVTQLNRLAFAASLCIRASPTWRPTMSEV 331 >ref|XP_006453346.1| probable receptor-like serine/threonine-protein kinase At5g57670 [Citrus clementina] ref|XP_006474198.1| PREDICTED: probable receptor-like serine/threonine-protein kinase At5g57670 [Citrus sinensis] gb|ESR66586.1| hypothetical protein CICLE_v10008604mg [Citrus clementina] Length = 386 Score = 59.7 bits (143), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL R+AFAASLCIRAS TWRPTMSEV Sbjct: 300 GAYDVTQLNRLAFAASLCIRASPTWRPTMSEV 331 >gb|PNY16873.1| putative receptor-like serine threonine-protein kinase [Trifolium pratense] Length = 329 Score = 59.3 bits (142), Expect = 5e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = +1 Query: 1 GEYDITQLRRVAFAASLCIRASSTWRPTMSEV 96 G YD+TQL R AFAASLCIRASSTWRPTM+EV Sbjct: 298 GAYDVTQLMRFAFAASLCIRASSTWRPTMTEV 329