BLASTX nr result
ID: Chrysanthemum22_contig00039073
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00039073 (518 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF92360.1| putative F-box domain, Leucine-rich repeat domain... 64 9e-09 ref|XP_022017438.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 64 1e-08 ref|XP_022020143.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 61 1e-07 ref|XP_022020418.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 58 1e-06 ref|XP_022020416.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 58 1e-06 ref|XP_022020378.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_022020146.1| F-box/FBD/LRR-repeat protein At1g13570-like ... 57 2e-06 ref|XP_022017619.1| uncharacterized protein LOC110917360 [Helian... 55 4e-06 >gb|OTF92360.1| putative F-box domain, Leucine-rich repeat domain, L domain-like protein [Helianthus annuus] Length = 387 Score = 63.9 bits (154), Expect = 9e-09 Identities = 33/82 (40%), Positives = 48/82 (58%) Frame = -3 Query: 405 ILKSAYEDDDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKE 226 I+ ++ + P PA+ S +VD++ +G LQLR V F+ G ENE C+ T LL CSPFLK Sbjct: 292 IIATSVSNVGPTPAICSPDVDYNTMGPLQLRSVGFIDLKGSENEVCLITCLLGCSPFLKR 351 Query: 225 MDISALEVLPVDDRESISSNSL 160 + I + L D++ S L Sbjct: 352 IGIRPHKSLARDEQLMFDSKLL 373 >ref|XP_022017438.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] Length = 408 Score = 63.9 bits (154), Expect = 1e-08 Identities = 33/82 (40%), Positives = 48/82 (58%) Frame = -3 Query: 405 ILKSAYEDDDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKE 226 I+ ++ + P PA+ S +VD++ +G LQLR V F+ G ENE C+ T LL CSPFLK Sbjct: 313 IIATSVSNVGPTPAICSPDVDYNTMGPLQLRSVGFIDLKGSENEVCLITCLLGCSPFLKR 372 Query: 225 MDISALEVLPVDDRESISSNSL 160 + I + L D++ S L Sbjct: 373 IGIRPHKSLARDEQLMFDSKLL 394 >ref|XP_022020143.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] Length = 393 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/62 (46%), Positives = 42/62 (67%) Frame = -3 Query: 402 LKSAYEDDDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEM 223 +++ YEDD P A+ +SE+D++ +GQLQLR V F F G ENE C+ LL SPFL+ + Sbjct: 304 IEAPYEDDVPTHALDTSEIDYNTVGQLQLRSVVFECFNGSENEMCLIKYLLASSPFLEYI 363 Query: 222 DI 217 + Sbjct: 364 TV 365 >ref|XP_022020418.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X2 [Helianthus annuus] Length = 404 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = -3 Query: 381 DDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEMDISALEV 202 D P P + S EVD++ +G L+LR V F + G ENE C+ LL CSPFLK++ I Sbjct: 317 DSPTPEICSLEVDYNTMGLLKLRSVVFTYYKGSENELCLVKYLLACSPFLKKIVIRPCSF 376 Query: 201 LPVDDR 184 L D++ Sbjct: 377 LESDEK 382 >ref|XP_022020416.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Helianthus annuus] ref|XP_022020417.1| F-box/FBD/LRR-repeat protein At1g13570-like isoform X1 [Helianthus annuus] Length = 432 Score = 57.8 bits (138), Expect = 1e-06 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = -3 Query: 381 DDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEMDISALEV 202 D P P + S EVD++ +G L+LR V F + G ENE C+ LL CSPFLK++ I Sbjct: 345 DSPTPEICSLEVDYNTMGLLKLRSVVFTYYKGSENELCLVKYLLACSPFLKKIVIRPCSF 404 Query: 201 LPVDDR 184 L D++ Sbjct: 405 LESDEK 410 >ref|XP_022020378.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] Length = 411 Score = 57.0 bits (136), Expect(2) = 2e-06 Identities = 32/73 (43%), Positives = 42/73 (57%) Frame = -3 Query: 402 LKSAYEDDDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEM 223 + ++Y DD P P S EVDF+ +G LQLR V F G ENE + LL CSPFLK++ Sbjct: 315 ITASYWDDSPTPGNCSLEVDFNTVGLLQLRDVVFTYLKGSENEVFLIKYLLACSPFLKKI 374 Query: 222 DISALEVLPVDDR 184 I L D++ Sbjct: 375 VIHPHSCLASDEK 387 Score = 22.3 bits (46), Expect(2) = 2e-06 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -1 Query: 515 DLICGFPNLETLLIKVS 465 ++I FPNLETL I S Sbjct: 302 EMIRSFPNLETLEITAS 318 >ref|XP_022020146.1| F-box/FBD/LRR-repeat protein At1g13570-like [Helianthus annuus] Length = 412 Score = 57.0 bits (136), Expect = 2e-06 Identities = 29/66 (43%), Positives = 40/66 (60%) Frame = -3 Query: 381 DDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEMDISALEV 202 D P P + S EVD++ +G L+LR V F + G ENE C+ LL CSPFLK++ I Sbjct: 325 DSPTPEICSLEVDYNTMGLLKLRSVVFKYYKGSENELCLVKYLLACSPFLKKIVIRPCSF 384 Query: 201 LPVDDR 184 L D++ Sbjct: 385 LESDEK 390 >ref|XP_022017619.1| uncharacterized protein LOC110917360 [Helianthus annuus] Length = 206 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/66 (42%), Positives = 39/66 (59%) Frame = -3 Query: 381 DDPLPAVPSSEVDFSRLGQLQLRKVEFVSFGGLENEECMRTSLLNCSPFLKEMDISALEV 202 D P P + S EVD++ +G L+LR V F + G ENE C+ L CSPFLK++ I Sbjct: 119 DSPTPEICSLEVDYNTMGLLKLRSVVFKYYKGSENELCLVKYLFACSPFLKKIVIRPCSF 178 Query: 201 LPVDDR 184 L D++ Sbjct: 179 LESDEK 184