BLASTX nr result
ID: Chrysanthemum22_contig00038771
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00038771 (370 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG33251.1| putative cysteine-rich transmembrane CYSTM domain... 50 8e-06 >gb|OTG33251.1| putative cysteine-rich transmembrane CYSTM domain-containing protein [Helianthus annuus] Length = 58 Score = 50.1 bits (118), Expect = 8e-06 Identities = 22/37 (59%), Positives = 29/37 (78%), Gaps = 3/37 (8%) Frame = +3 Query: 60 MSEAPKKQEMS---RHQDVQNRKEERGCPYSCFYTLF 161 MSEAPK Q+MS H +Q+R+EERGC Y+CF+T+F Sbjct: 1 MSEAPKTQQMSYNDTHHRIQHRREERGCLYACFFTMF 37