BLASTX nr result
ID: Chrysanthemum22_contig00038273
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00038273 (464 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021997620.1| pentatricopeptide repeat-containing protein ... 94 2e-19 gb|PLY68095.1| hypothetical protein LSAT_8X27581 [Lactuca sativa] 91 2e-18 ref|XP_023741272.1| pentatricopeptide repeat-containing protein ... 91 2e-18 gb|PHT38804.1| Pentatricopeptide repeat-containing protein [Caps... 86 5e-18 ref|XP_017229382.1| PREDICTED: pentatricopeptide repeat-containi... 90 5e-18 gb|PKI43027.1| hypothetical protein CRG98_036605 [Punica granatum] 86 6e-18 gb|PHT38806.1| Pentatricopeptide repeat-containing protein [Caps... 86 7e-18 gb|PRQ42458.1| putative DYW domain-containing protein [Rosa chin... 83 9e-18 ref|XP_022895179.1| pentatricopeptide repeat-containing protein ... 89 1e-17 ref|XP_020107552.1| pentatricopeptide repeat-containing protein ... 89 1e-17 ref|XP_008799669.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-17 gb|PAN52971.1| hypothetical protein PAHAL_J01481 [Panicum hallii] 84 2e-17 ref|XP_007156184.1| hypothetical protein PHAVU_003G265400g [Phas... 88 2e-17 gb|KDO40959.1| hypothetical protein CISIN_1g0075301mg, partial [... 82 3e-17 ref|XP_012081585.1| pentatricopeptide repeat-containing protein ... 84 4e-17 ref|XP_010246056.2| PREDICTED: pentatricopeptide repeat-containi... 87 4e-17 gb|PKI71458.1| hypothetical protein CRG98_008131 [Punica granatum] 81 5e-17 ref|XP_017412584.1| PREDICTED: pentatricopeptide repeat-containi... 87 6e-17 ref|XP_023538947.1| pentatricopeptide repeat-containing protein ... 87 6e-17 ref|XP_022974384.1| pentatricopeptide repeat-containing protein ... 87 6e-17 >ref|XP_021997620.1| pentatricopeptide repeat-containing protein At2g13600-like [Helianthus annuus] gb|OTG04862.1| putative tetratricopeptide-like helical domain, DYW domain protein [Helianthus annuus] Length = 906 Score = 94.4 bits (233), Expect = 2e-19 Identities = 39/46 (84%), Positives = 43/46 (93%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRICDDCH+ MKLASRVTSREL++RDANRFH F+DG CSCRDYW Sbjct: 861 KNLRICDDCHLVMKLASRVTSRELVIRDANRFHRFKDGGCSCRDYW 906 >gb|PLY68095.1| hypothetical protein LSAT_8X27581 [Lactuca sativa] Length = 786 Score = 91.3 bits (225), Expect = 2e-18 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRICDDCH MKL S VTSREL++RDANRFHHF+DG CSCRDYW Sbjct: 741 KNLRICDDCHSVMKLVSLVTSRELVIRDANRFHHFRDGFCSCRDYW 786 >ref|XP_023741272.1| pentatricopeptide repeat-containing protein At2g13600-like [Lactuca sativa] Length = 918 Score = 91.3 bits (225), Expect = 2e-18 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRICDDCH MKL S VTSREL++RDANRFHHF+DG CSCRDYW Sbjct: 873 KNLRICDDCHSVMKLVSLVTSRELVIRDANRFHHFRDGFCSCRDYW 918 >gb|PHT38804.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 197 Score = 86.3 bits (212), Expect = 5e-18 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC+DCH FMKLAS+V RE++VRD RFHH++DGSCSC+DYW Sbjct: 152 KNLRICEDCHNFMKLASKVFEREIVVRDRTRFHHYRDGSCSCKDYW 197 >ref|XP_017229382.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Daucus carota subsp. sativus] ref|XP_017229383.1| PREDICTED: pentatricopeptide repeat-containing protein At2g13600-like [Daucus carota subsp. sativus] gb|KZN10312.1| hypothetical protein DCAR_002968 [Daucus carota subsp. sativus] Length = 906 Score = 90.1 bits (222), Expect = 5e-18 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH+ MKL S VTSRELIVRDANRFHHF+DG+CSC+DYW Sbjct: 861 KNLRICRDCHLLMKLISLVTSRELIVRDANRFHHFKDGTCSCKDYW 906 >gb|PKI43027.1| hypothetical protein CRG98_036605 [Punica granatum] Length = 202 Score = 86.3 bits (212), Expect = 6e-18 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH FMKLAS +T RE+IVRD NRFHHF DGSCSC D+W Sbjct: 157 KNLRICVDCHSFMKLASSITGREIIVRDTNRFHHFTDGSCSCGDFW 202 >gb|PHT38806.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 213 Score = 86.3 bits (212), Expect = 7e-18 Identities = 34/46 (73%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC+DCH FMKLAS+V RE++VRD RFHH++DGSCSC+DYW Sbjct: 168 KNLRICEDCHNFMKLASKVFEREIVVRDRTRFHHYRDGSCSCKDYW 213 >gb|PRQ42458.1| putative DYW domain-containing protein [Rosa chinensis] Length = 107 Score = 83.2 bits (204), Expect = 9e-18 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLR+C DCH +KL ++ T RE+IVRDANRFHHF+DG CSCRDYW Sbjct: 62 KNLRVCGDCHSAIKLIAKATGREIIVRDANRFHHFKDGLCSCRDYW 107 >ref|XP_022895179.1| pentatricopeptide repeat-containing protein At2g13600-like [Olea europaea var. sylvestris] Length = 915 Score = 89.4 bits (220), Expect = 1e-17 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH+ MKL S VTSRELI+RDANRFHHF+DGSCSC DYW Sbjct: 870 KNLRICQDCHLVMKLISFVTSRELIIRDANRFHHFKDGSCSCGDYW 915 >ref|XP_020107552.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107553.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107555.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107556.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107557.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107558.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107559.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107560.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] ref|XP_020107561.1| pentatricopeptide repeat-containing protein At5g04780 [Ananas comosus] Length = 601 Score = 89.0 bits (219), Expect = 1e-17 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLR+C DCH FMKLASR+T RE+IVRD NRFHHF GSCSCRD+W Sbjct: 556 KNLRVCGDCHSFMKLASRITGREIIVRDLNRFHHFSGGSCSCRDFW 601 >ref|XP_008799669.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Phoenix dactylifera] ref|XP_008799670.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Phoenix dactylifera] ref|XP_008799671.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Phoenix dactylifera] ref|XP_017700033.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Phoenix dactylifera] Length = 646 Score = 88.6 bits (218), Expect = 2e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH F+KLASR+T RE+IVRD NRFHHF+DG CSCRD+W Sbjct: 601 KNLRICRDCHSFIKLASRITGREIIVRDTNRFHHFKDGICSCRDFW 646 >gb|PAN52971.1| hypothetical protein PAHAL_J01481 [Panicum hallii] Length = 188 Score = 84.3 bits (207), Expect = 2e-17 Identities = 32/46 (69%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLR+C DCH +KL +++TSRE+++RDANRFHHF+DG CSCRDYW Sbjct: 143 KNLRVCGDCHSAIKLIAKITSREIVLRDANRFHHFKDGFCSCRDYW 188 >ref|XP_007156184.1| hypothetical protein PHAVU_003G265400g [Phaseolus vulgaris] gb|ESW28178.1| hypothetical protein PHAVU_003G265400g [Phaseolus vulgaris] Length = 619 Score = 88.2 bits (217), Expect = 2e-17 Identities = 36/46 (78%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH+FMKL S+ TSRE+IVRD NRFHHF+DG CSCRD+W Sbjct: 574 KNLRICGDCHIFMKLMSKFTSREIIVRDTNRFHHFKDGFCSCRDFW 619 >gb|KDO40959.1| hypothetical protein CISIN_1g0075301mg, partial [Citrus sinensis] Length = 116 Score = 82.0 bits (201), Expect = 3e-17 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH FMK ASR+ RE IVRD NRFHHF +GSCSC D+W Sbjct: 71 KNLRICGDCHSFMKFASRIAGRETIVRDLNRFHHFTNGSCSCWDFW 116 >ref|XP_012081585.1| pentatricopeptide repeat-containing protein At5g04780 [Jatropha curcas] gb|KDP29817.1| hypothetical protein JCGZ_19156 [Jatropha curcas] Length = 202 Score = 84.0 bits (206), Expect = 4e-17 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH FM LAS +T R++IVRD NRFHHF+DG CSCR++W Sbjct: 157 KNLRICGDCHSFMNLASSITKRDIIVRDVNRFHHFKDGCCSCREFW 202 >ref|XP_010246056.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Nelumbo nucifera] ref|XP_010246065.2| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Nelumbo nucifera] ref|XP_019051886.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Nelumbo nucifera] Length = 622 Score = 87.4 bits (215), Expect = 4e-17 Identities = 36/46 (78%), Positives = 39/46 (84%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH FMKLASR+T R +IVRD NRFHHF GSCSCRD+W Sbjct: 577 KNLRICGDCHSFMKLASRITRRNIIVRDTNRFHHFSGGSCSCRDFW 622 >gb|PKI71458.1| hypothetical protein CRG98_008131 [Punica granatum] Length = 105 Score = 81.3 bits (199), Expect = 5e-17 Identities = 31/46 (67%), Positives = 37/46 (80%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KN+R+C DCH K AS+ RE+I+RD NRFHHF+DGSCSCRDYW Sbjct: 60 KNIRVCGDCHSAFKFASKAVEREIILRDTNRFHHFRDGSCSCRDYW 105 >ref|XP_017412584.1| PREDICTED: pentatricopeptide repeat-containing protein At5g04780 [Vigna angularis] Length = 427 Score = 86.7 bits (213), Expect = 6e-17 Identities = 35/46 (76%), Positives = 41/46 (89%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC DCH+FMKL S+ TSRE+IVRD NRFHHF+DG CSCR++W Sbjct: 382 KNLRICGDCHIFMKLMSKFTSREIIVRDTNRFHHFRDGFCSCREFW 427 >ref|XP_023538947.1| pentatricopeptide repeat-containing protein At4g14820 [Cucurbita pepo subsp. pepo] ref|XP_023538948.1| pentatricopeptide repeat-containing protein At4g14820 [Cucurbita pepo subsp. pepo] Length = 726 Score = 87.0 bits (214), Expect = 6e-17 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC+DCH FMKLAS+V +RE++VRD RFHH++DGSCSC+DYW Sbjct: 681 KNLRICEDCHAFMKLASKVYAREIVVRDRTRFHHYRDGSCSCKDYW 726 >ref|XP_022974384.1| pentatricopeptide repeat-containing protein At4g14820-like [Cucurbita maxima] ref|XP_022975405.1| pentatricopeptide repeat-containing protein At4g14820-like isoform X1 [Cucurbita maxima] ref|XP_022975406.1| pentatricopeptide repeat-containing protein At4g14820-like isoform X1 [Cucurbita maxima] Length = 726 Score = 87.0 bits (214), Expect = 6e-17 Identities = 34/46 (73%), Positives = 42/46 (91%) Frame = -2 Query: 463 KNLRICDDCHMFMKLASRVTSRELIVRDANRFHHFQDGSCSCRDYW 326 KNLRIC+DCH FMKLAS+V +RE++VRD RFHH++DGSCSC+DYW Sbjct: 681 KNLRICEDCHAFMKLASKVYAREIVVRDRTRFHHYRDGSCSCKDYW 726