BLASTX nr result
ID: Chrysanthemum22_contig00038263
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00038263 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTF96991.1| putative RNA-binding, CRM domain-containing prote... 54 2e-06 ref|XP_022008726.1| CRM-domain containing factor CFM2, chloropla... 54 2e-06 ref|XP_022011455.1| CRM-domain containing factor CFM2, chloropla... 56 5e-06 ref|XP_022011454.1| CRM-domain containing factor CFM2, chloropla... 56 5e-06 gb|OTF94648.1| putative CRM family member 2 [Helianthus annuus] 56 5e-06 >gb|OTF96991.1| putative RNA-binding, CRM domain-containing protein [Helianthus annuus] Length = 90 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -3 Query: 149 DKMKRLL*FELGHETQNSLGSSVLITEGIVHGIHERWRRNELVKIVCED 3 D+++RL + +T+ +G + IT GIV+GIHERWRR ELVKIVCED Sbjct: 9 DELRRLRSLGIAIKTRLKIGQA-RITGGIVNGIHERWRRTELVKIVCED 56 >ref|XP_022008726.1| CRM-domain containing factor CFM2, chloroplastic-like [Helianthus annuus] Length = 100 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = -3 Query: 149 DKMKRLL*FELGHETQNSLGSSVLITEGIVHGIHERWRRNELVKIVCED 3 D+++RL + +T+ +G + IT GIV+GIHERWRR ELVKIVCED Sbjct: 9 DELRRLRSLGIAIKTRLKIGQA-RITGGIVNGIHERWRRTELVKIVCED 56 >ref|XP_022011455.1| CRM-domain containing factor CFM2, chloroplastic isoform X2 [Helianthus annuus] Length = 1013 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 149 DKMKRLL*FELGHETQNSLGSSVLITEGIVHGIHERWRRNELVKIVCED 3 D+++RL + +T+ +G + ITEGIV+GIHERWRR ELVKIVCED Sbjct: 172 DELRRLRSLGIAIKTRLKIGKAG-ITEGIVNGIHERWRRTELVKIVCED 219 >ref|XP_022011454.1| CRM-domain containing factor CFM2, chloroplastic isoform X1 [Helianthus annuus] Length = 1015 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 149 DKMKRLL*FELGHETQNSLGSSVLITEGIVHGIHERWRRNELVKIVCED 3 D+++RL + +T+ +G + ITEGIV+GIHERWRR ELVKIVCED Sbjct: 172 DELRRLRSLGIAIKTRLKIGKAG-ITEGIVNGIHERWRRTELVKIVCED 219 >gb|OTF94648.1| putative CRM family member 2 [Helianthus annuus] Length = 1029 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/49 (57%), Positives = 37/49 (75%) Frame = -3 Query: 149 DKMKRLL*FELGHETQNSLGSSVLITEGIVHGIHERWRRNELVKIVCED 3 D+++RL + +T+ +G + ITEGIV+GIHERWRR ELVKIVCED Sbjct: 172 DELRRLRSLGIAIKTRLKIGKAG-ITEGIVNGIHERWRRTELVKIVCED 219