BLASTX nr result
ID: Chrysanthemum22_contig00038247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00038247 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021981194.1| probable serine/threonine-protein kinase PBL... 55 4e-06 >ref|XP_021981194.1| probable serine/threonine-protein kinase PBL15 [Helianthus annuus] Length = 237 Score = 54.7 bits (130), Expect = 4e-06 Identities = 24/41 (58%), Positives = 34/41 (82%) Frame = +2 Query: 2 IDRLFNYDKKESMEDIAKLCFEICNEVNSESKMVTILQKYD 124 IDRLF+ S++ +A+LCFE+CNEV+SESKMVT+L ++D Sbjct: 181 IDRLFHQCGNGSLQHVAQLCFELCNEVDSESKMVTMLNEHD 221