BLASTX nr result
ID: Chrysanthemum22_contig00037788
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037788 (443 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OTG07289.1| putative isoprenoid synthase domain-containing pr... 60 8e-08 sp|I6RE61.1|TPS4_MATCR RecName: Full=(E)-beta-ocimene synthase, ... 57 1e-06 >gb|OTG07289.1| putative isoprenoid synthase domain-containing protein [Helianthus annuus] Length = 294 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 443 GFLALYNTINEMGYDTLTAQGVNIIPILAKV 351 GFLALYNTIN+MGYDTL AQG NIIPILAKV Sbjct: 71 GFLALYNTINDMGYDTLVAQGTNIIPILAKV 101 >sp|I6RE61.1|TPS4_MATCR RecName: Full=(E)-beta-ocimene synthase, chloroplastic; AltName: Full=Terpene synthase 4; Flags: Precursor gb|AFM43737.1| terpene synthase 4 [Matricaria chamomilla var. recutita] Length = 596 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -1 Query: 443 GFLALYNTINEMGYDTLTAQGVNIIPILAKV 351 GFLALYNTINEMGY+TL+AQG+NIIP LA+V Sbjct: 381 GFLALYNTINEMGYETLSAQGINIIPNLARV 411