BLASTX nr result
ID: Chrysanthemum22_contig00037780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037780 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH99251.1| Calponin homology domain-containing protein [Cyna... 63 5e-09 gb|OTG26588.1| putative kinesin-like protein 1 [Helianthus annuus] 54 8e-06 ref|XP_022039587.1| kinesin-like protein KIN-14F isoform X2 [Hel... 54 8e-06 ref|XP_022039586.1| kinesin-like protein KIN-14F isoform X1 [Hel... 54 8e-06 >gb|KVH99251.1| Calponin homology domain-containing protein [Cynara cardunculus var. scolymus] Length = 904 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/45 (64%), Positives = 38/45 (84%) Frame = +3 Query: 3 RSLATLPVLPSTENEKGDLSSQDNFSEALHNHPRTNSRKANH*QK 137 RSLATLP+LPST+N++G LSSQD SE+LHN P+ N++KAN Q+ Sbjct: 766 RSLATLPILPSTDNKRGYLSSQDTVSESLHNLPKANNKKANQEQE 810 >gb|OTG26588.1| putative kinesin-like protein 1 [Helianthus annuus] Length = 1054 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 RSLATLPVLPSTENEKGDLSSQDNFSEALHNHPRTNSRKANH 128 RSLATLP+LPST+ ++ DNFSEAL N PR NSRKANH Sbjct: 892 RSLATLPILPSTDTKR------DNFSEALLNLPRINSRKANH 927 >ref|XP_022039587.1| kinesin-like protein KIN-14F isoform X2 [Helianthus annuus] Length = 1078 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 RSLATLPVLPSTENEKGDLSSQDNFSEALHNHPRTNSRKANH 128 RSLATLP+LPST+ ++ DNFSEAL N PR NSRKANH Sbjct: 916 RSLATLPILPSTDTKR------DNFSEALLNLPRINSRKANH 951 >ref|XP_022039586.1| kinesin-like protein KIN-14F isoform X1 [Helianthus annuus] Length = 1079 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/42 (66%), Positives = 32/42 (76%) Frame = +3 Query: 3 RSLATLPVLPSTENEKGDLSSQDNFSEALHNHPRTNSRKANH 128 RSLATLP+LPST+ ++ DNFSEAL N PR NSRKANH Sbjct: 917 RSLATLPILPSTDTKR------DNFSEALLNLPRINSRKANH 952