BLASTX nr result
ID: Chrysanthemum22_contig00037660
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037660 (477 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY99163.1| hypothetical protein LSAT_6X78501 [Lactuca sativa] 74 8e-15 >gb|PLY99163.1| hypothetical protein LSAT_6X78501 [Lactuca sativa] Length = 62 Score = 74.3 bits (181), Expect = 8e-15 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 11/61 (18%) Frame = -2 Query: 380 MAPHLPLVKP-----------LPKQSCQYKYLPQRPIVLQVAPTKEATMVNRKPGSLIVV 234 MAP + VKP LP+QSCQY+YLPQRPI+LQVAPTKEA MVN KP SL+V+ Sbjct: 1 MAPQVHHVKPVFEASGGRSSSLPQQSCQYQYLPQRPIILQVAPTKEAAMVNYKPRSLVVI 60 Query: 233 G 231 G Sbjct: 61 G 61