BLASTX nr result
ID: Chrysanthemum22_contig00037591
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037591 (356 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021987934.1| protein trichome birefringence-like 34 [Heli... 43 6e-08 gb|KVH94882.1| PC-Esterase [Cynara cardunculus var. scolymus] 41 7e-06 >ref|XP_021987934.1| protein trichome birefringence-like 34 [Helianthus annuus] gb|OTG10457.1| putative PMR5 N-terminal domain, PC-Esterase, Trichome birefringence-like family [Helianthus annuus] Length = 461 Score = 42.7 bits (99), Expect(2) = 6e-08 Identities = 31/83 (37%), Positives = 40/83 (48%), Gaps = 16/83 (19%) Frame = +2 Query: 68 FLGLPGDYSHYEESCSSTCAAD*GGKSQGTCYQV-------------FNQNAKNVL---L 199 F+GL +S+ A D GGK Q TCY+ + +L L Sbjct: 331 FMGLTATHSN---------AMDWGGKKQQTCYKEKEPVMVDGFWESGTDPKMLRILESSL 381 Query: 200 EKLKAKGTNVQFINLTQLTQTKK 268 KLKAKG NVQ +N+TQLTQ +K Sbjct: 382 SKLKAKGVNVQLLNITQLTQYRK 404 Score = 41.6 bits (96), Expect(2) = 6e-08 Identities = 16/31 (51%), Positives = 25/31 (80%) Frame = +1 Query: 262 KKNAYPAIY*RLWGPLTDKQVNNPQRSSDIT 354 +K+A+P ++ RLW PL+++Q NPQR+SD T Sbjct: 403 RKDAHPTVHRRLWRPLSEEQKKNPQRASDCT 433 >gb|KVH94882.1| PC-Esterase [Cynara cardunculus var. scolymus] Length = 233 Score = 40.8 bits (94), Expect(2) = 7e-06 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +1 Query: 262 KKNAYPAIY*RLWGPLTDKQVNNPQRSSDIT 354 +K+A+P ++ +LW PLTD Q NP R+SD T Sbjct: 175 RKDAHPTVHRKLWRPLTDDQQKNPHRASDCT 205 Score = 36.6 bits (83), Expect(2) = 7e-06 Identities = 16/24 (66%), Positives = 20/24 (83%) Frame = +2 Query: 197 LEKLKAKGTNVQFINLTQLTQTKK 268 L +LKAKG NV+ IN+TQLTQ +K Sbjct: 153 LNRLKAKGVNVKLINITQLTQCRK 176