BLASTX nr result
ID: Chrysanthemum22_contig00037569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037569 (467 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023762125.1| uncharacterized protein LOC111910520 [Lactuc... 54 3e-06 gb|PLY93832.1| hypothetical protein LSAT_6X85200 [Lactuca sativa] 53 5e-06 >ref|XP_023762125.1| uncharacterized protein LOC111910520 [Lactuca sativa] Length = 126 Score = 53.9 bits (128), Expect = 3e-06 Identities = 23/39 (58%), Positives = 26/39 (66%), Gaps = 4/39 (10%) Frame = +2 Query: 143 IKTSWTNRNPCRRFYCC----LACGFIGWTDPLMCCRAR 247 +KTSWT NP RRFY C CGFIGW DP MC R++ Sbjct: 12 VKTSWTPLNPGRRFYACPTKDSVCGFIGWVDPPMCARSK 50 >gb|PLY93832.1| hypothetical protein LSAT_6X85200 [Lactuca sativa] Length = 109 Score = 52.8 bits (125), Expect = 5e-06 Identities = 20/32 (62%), Positives = 25/32 (78%) Frame = +2 Query: 149 TSWTNRNPCRRFYCCLACGFIGWTDPLMCCRA 244 TSWT+RNP R+F+ C CGF+ W+DP MC RA Sbjct: 14 TSWTDRNPGRQFWNCTRCGFLRWSDPPMCARA 45