BLASTX nr result
ID: Chrysanthemum22_contig00037404
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037404 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022001019.1| tRNA (cytosine(38)-C(5))-methyltransferase [... 62 1e-08 ref|XP_010254328.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 59 1e-07 ref|XP_010254327.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 59 1e-07 ref|XP_010254326.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 59 1e-07 ref|XP_010254325.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 59 1e-07 gb|KVH90290.1| C-5 cytosine methyltransferase [Cynara cardunculu... 59 2e-07 gb|PKI58685.1| hypothetical protein CRG98_020951, partial [Punic... 54 3e-07 ref|XP_023735282.1| tRNA (cytosine(38)-C(5))-methyltransferase i... 58 4e-07 gb|PKI65424.1| hypothetical protein CRG98_014163 [Punica granatum] 54 7e-07 ref|XP_019424702.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 57 7e-07 ref|XP_021664148.1| tRNA (cytosine(38)-C(5))-methyltransferase-l... 57 8e-07 ref|XP_008445163.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 57 8e-07 gb|PNX84313.1| tRNA (cytosine(38)-C(5))-methyltransferase-like p... 54 8e-07 ref|XP_019424700.1| PREDICTED: tRNA (cytosine-5-)-methyltransfer... 57 8e-07 ref|XP_021664147.1| tRNA (cytosine(38)-C(5))-methyltransferase-l... 57 9e-07 ref|XP_021643031.1| tRNA (cytosine(38)-C(5))-methyltransferase-l... 57 9e-07 ref|XP_014517685.1| tRNA (cytosine(38)-C(5))-methyltransferase [... 57 9e-07 ref|XP_017434331.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 57 9e-07 ref|XP_008445162.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltr... 57 9e-07 ref|XP_006597031.1| PREDICTED: uncharacterized protein LOC100792... 57 1e-06 >ref|XP_022001019.1| tRNA (cytosine(38)-C(5))-methyltransferase [Helianthus annuus] gb|OTG01498.1| putative DNA methyltransferase-2 [Helianthus annuus] Length = 359 Score = 62.0 bits (149), Expect = 1e-08 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EHVTLRQRYALLGNSLSV VVAPLL YLFSDP Sbjct: 328 EHVTLRQRYALLGNSLSVAVVAPLLHYLFSDP 359 >ref|XP_010254328.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X4 [Nelumbo nucifera] Length = 311 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLSV VVAPL RYLFSDP Sbjct: 279 QHISLRQRYALLGNSLSVAVVAPLFRYLFSDP 310 >ref|XP_010254327.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X3 [Nelumbo nucifera] Length = 377 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLSV VVAPL RYLFSDP Sbjct: 345 QHISLRQRYALLGNSLSVAVVAPLFRYLFSDP 376 >ref|XP_010254326.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X2 [Nelumbo nucifera] Length = 384 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLSV VVAPL RYLFSDP Sbjct: 352 QHISLRQRYALLGNSLSVAVVAPLFRYLFSDP 383 >ref|XP_010254325.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Nelumbo nucifera] Length = 388 Score = 59.3 bits (142), Expect = 1e-07 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLSV VVAPL RYLFSDP Sbjct: 356 QHISLRQRYALLGNSLSVAVVAPLFRYLFSDP 387 >gb|KVH90290.1| C-5 cytosine methyltransferase [Cynara cardunculus var. scolymus] Length = 363 Score = 58.9 bits (141), Expect = 2e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EHVTLRQRYALLGNSLS VVAPLL YLFS+P Sbjct: 332 EHVTLRQRYALLGNSLSAAVVAPLLHYLFSEP 363 >gb|PKI58685.1| hypothetical protein CRG98_020951, partial [Punica granatum] Length = 67 Score = 54.3 bits (129), Expect = 3e-07 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSD 309 +HV+LRQRYALLGNSLSV VVAPLL+YLF++ Sbjct: 36 QHVSLRQRYALLGNSLSVAVVAPLLQYLFTE 66 >ref|XP_023735282.1| tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Lactuca sativa] gb|PLY72693.1| hypothetical protein LSAT_6X22181 [Lactuca sativa] Length = 351 Score = 57.8 bits (138), Expect = 4e-07 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSD 309 EHVTLRQRYALLGNSLSV VVAPLL YLFS+ Sbjct: 320 EHVTLRQRYALLGNSLSVAVVAPLLHYLFSE 350 >gb|PKI65424.1| hypothetical protein CRG98_014163 [Punica granatum] Length = 73 Score = 53.5 bits (127), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = -1 Query: 398 HVTLRQRYALLGNSLSVVVVAPLLRYLFSD 309 HV+LRQRYALLGNSLSV VVAPLL+YLF++ Sbjct: 43 HVSLRQRYALLGNSLSVTVVAPLLQYLFTE 72 >ref|XP_019424702.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X2 [Lupinus angustifolius] Length = 298 Score = 57.0 bits (136), Expect = 7e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EH++LRQRYALLGNSLS+ VVAPLL YLF++P Sbjct: 266 EHISLRQRYALLGNSLSIAVVAPLLNYLFTEP 297 >ref|XP_021664148.1| tRNA (cytosine(38)-C(5))-methyltransferase-like isoform X2 [Hevea brasiliensis] Length = 324 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLS+ VVAPLLRYLF+ P Sbjct: 292 QHISLRQRYALLGNSLSIAVVAPLLRYLFTQP 323 >ref|XP_008445163.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X2 [Cucumis melo] Length = 338 Score = 57.0 bits (136), Expect = 8e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H+ LRQRYALLGNSLSV VVAPLLRYLF++P Sbjct: 306 QHIGLRQRYALLGNSLSVAVVAPLLRYLFTEP 337 >gb|PNX84313.1| tRNA (cytosine(38)-C(5))-methyltransferase-like protein, partial [Trifolium pratense] Length = 81 Score = 53.5 bits (127), Expect = 8e-07 Identities = 23/31 (74%), Positives = 30/31 (96%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSD 309 EH++L+QRYALLGNSLS+ VVAPLL+YLF++ Sbjct: 50 EHISLKQRYALLGNSLSIAVVAPLLQYLFTE 80 >ref|XP_019424700.1| PREDICTED: tRNA (cytosine-5-)-methyltransferase isoform X1 [Lupinus angustifolius] ref|XP_019424701.1| PREDICTED: tRNA (cytosine-5-)-methyltransferase isoform X1 [Lupinus angustifolius] Length = 372 Score = 57.0 bits (136), Expect = 8e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EH++LRQRYALLGNSLS+ VVAPLL YLF++P Sbjct: 340 EHISLRQRYALLGNSLSIAVVAPLLNYLFTEP 371 >ref|XP_021664147.1| tRNA (cytosine(38)-C(5))-methyltransferase-like isoform X1 [Hevea brasiliensis] Length = 385 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLS+ VVAPLLRYLF+ P Sbjct: 353 QHISLRQRYALLGNSLSIAVVAPLLRYLFTQP 384 >ref|XP_021643031.1| tRNA (cytosine(38)-C(5))-methyltransferase-like [Hevea brasiliensis] Length = 385 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H++LRQRYALLGNSLS+ VVAPLLRYLF+ P Sbjct: 353 QHISLRQRYALLGNSLSIAVVAPLLRYLFTQP 384 >ref|XP_014517685.1| tRNA (cytosine(38)-C(5))-methyltransferase [Vigna radiata var. radiata] Length = 385 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EHV+L+QRYALLGNSLS+ VVAPLL+YLF++P Sbjct: 354 EHVSLKQRYALLGNSLSIAVVAPLLKYLFTEP 385 >ref|XP_017434331.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase [Vigna angularis] gb|KOM53966.1| hypothetical protein LR48_Vigan09g262500 [Vigna angularis] dbj|BAT86887.1| hypothetical protein VIGAN_05021600 [Vigna angularis var. angularis] Length = 385 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/32 (78%), Positives = 31/32 (96%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EHV+L+QRYALLGNSLS+ VVAPLL+YLF++P Sbjct: 354 EHVSLKQRYALLGNSLSIAVVAPLLKYLFTEP 385 >ref|XP_008445162.1| PREDICTED: tRNA (cytosine(38)-C(5))-methyltransferase isoform X1 [Cucumis melo] Length = 385 Score = 57.0 bits (136), Expect = 9e-07 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 +H+ LRQRYALLGNSLSV VVAPLLRYLF++P Sbjct: 353 QHIGLRQRYALLGNSLSVAVVAPLLRYLFTEP 384 >ref|XP_006597031.1| PREDICTED: uncharacterized protein LOC100792567 isoform X1 [Glycine max] Length = 308 Score = 56.6 bits (135), Expect = 1e-06 Identities = 25/32 (78%), Positives = 30/32 (93%) Frame = -1 Query: 401 EHVTLRQRYALLGNSLSVVVVAPLLRYLFSDP 306 EH++LRQRYALLGNSLS+ VVAPLL+YLF+ P Sbjct: 277 EHISLRQRYALLGNSLSIAVVAPLLQYLFTQP 308