BLASTX nr result
ID: Chrysanthemum22_contig00037367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037367 (941 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cy... 42 4e-06 >gb|KVH88997.1| Nucleotide-binding, alpha-beta plait, partial [Cynara cardunculus var. scolymus] Length = 349 Score = 41.6 bits (96), Expect(2) = 4e-06 Identities = 23/42 (54%), Positives = 27/42 (64%), Gaps = 7/42 (16%) Frame = -1 Query: 323 NISTCLLSFYTILT-------RSSHALTSLPAISQELSSWDL 219 N+S CL SFY+ + RS H+L SLPAISQ LS WDL Sbjct: 3 NLSACLPSFYSQMESFYISFIRSYHSLASLPAISQGLSWWDL 44 Score = 38.5 bits (88), Expect(2) = 4e-06 Identities = 17/27 (62%), Positives = 21/27 (77%) Frame = -3 Query: 180 GLMN*ILTCLALPILNTCCEHGEACLS 100 G+MN IL CL P LNTCC++GE CL+ Sbjct: 56 GVMNSILPCL--PFLNTCCQNGEPCLA 80