BLASTX nr result
ID: Chrysanthemum22_contig00037340
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037340 (395 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023747787.1| uncharacterized protein LOC111895980 [Lactuc... 54 7e-06 >ref|XP_023747787.1| uncharacterized protein LOC111895980 [Lactuca sativa] Length = 214 Score = 53.5 bits (127), Expect = 7e-06 Identities = 25/74 (33%), Positives = 40/74 (54%), Gaps = 4/74 (5%) Frame = -2 Query: 298 WNNWILKKV*----RMCLRSFLQIDFLI*SILVLEVCRCPLCSMEPESLEHCLINCSLVE 131 WNNW+ K+ R+ L+S + L +++E CP+CS E++ H CS + Sbjct: 50 WNNWVPIKLNILTWRVKLQSIPTRERLSSRGILVETIMCPICSCSVETIHHLFAGCSDLM 109 Query: 130 LVWAKVGSWWGLNL 89 +W ++ WWGLNL Sbjct: 110 DIWTRIAIWWGLNL 123