BLASTX nr result
ID: Chrysanthemum22_contig00037215
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00037215 (353 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI03912.1| CO/COL/TOC1, conserved site-containing protein [C... 57 5e-07 >gb|KVI03912.1| CO/COL/TOC1, conserved site-containing protein [Cynara cardunculus var. scolymus] Length = 304 Score = 57.0 bits (136), Expect = 5e-07 Identities = 29/53 (54%), Positives = 38/53 (71%), Gaps = 4/53 (7%) Frame = +3 Query: 3 KSKRKAESSACAS-LDAHLSQ---SQNQNEQIIRSLPCSPPPIRSPNTPNRYS 149 KSKRKA + ACA+ +D +L+ + N +EQ RS CSPPP+R PNTPNR+S Sbjct: 252 KSKRKAGAPACATTIDVYLNHQIGNHNLHEQSSRSATCSPPPVRPPNTPNRFS 304