BLASTX nr result
ID: Chrysanthemum22_contig00036907
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00036907 (546 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021969634.1| bifunctional L-3-cyanoalanine synthase/cyste... 68 4e-10 gb|KVH89058.1| Cysteine synthase/cystathionine beta-synthase P-p... 68 5e-10 ref|XP_022035773.1| bifunctional L-3-cyanoalanine synthase/cyste... 68 5e-10 ref|XP_023754250.1| bifunctional L-3-cyanoalanine synthase/cyste... 68 5e-10 gb|KRH74905.1| hypothetical protein GLYMA_01G051100 [Glycine max] 62 1e-09 gb|KZV21808.1| bifunctional L-3-cyanoalanine synthase/cysteine s... 67 1e-09 ref|XP_003623997.1| cysteine synthase/L-3-cyanoalanine synthase ... 66 2e-09 ref|XP_013449345.1| cysteine synthase/L-3-cyanoalanine synthase ... 66 2e-09 ref|XP_008343406.2| PREDICTED: L-3-cyanoalanine synthase 2, mito... 65 2e-09 ref|NP_001280949.1| L-3-cyanoalanine synthase 1, mitochondrial [... 66 2e-09 gb|AQZ26214.1| beta-cyanoalanine synthase [Medicago sativa] 66 2e-09 ref|XP_003623996.1| cysteine synthase/L-3-cyanoalanine synthase ... 66 2e-09 ref|XP_009349262.2| PREDICTED: L-3-cyanoalanine synthase 1, mito... 65 3e-09 ref|XP_011092647.1| bifunctional L-3-cyanoalanine synthase/cyste... 65 4e-09 ref|XP_009367811.1| PREDICTED: L-3-cyanoalanine synthase 2, mito... 65 5e-09 emb|CDP08794.1| unnamed protein product [Coffea canephora] 65 5e-09 ref|NP_001280751.1| L-3-cyanoalanine synthase 2, mitochondrial [... 65 5e-09 gb|PRQ19891.1| putative L-3-cyanoalanine synthase [Rosa chinensis] 63 5e-09 dbj|BAD19048.1| beta-cyanoalanine synthase, partial [Diospyros k... 64 5e-09 gb|PRQ22486.1| L-3-cyanoalanine synthase 1 [Rosa chinensis] 63 6e-09 >ref|XP_021969634.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial [Helianthus annuus] gb|OTG22317.1| putative cycloartenol synthase [Helianthus annuus] Length = 368 Score = 68.2 bits (165), Expect = 4e-10 Identities = 32/48 (66%), Positives = 36/48 (75%) Frame = +3 Query: 237 SEKVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 + KVH E +G IWDDTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 197 NSKVHFETTGPEIWDDTNGKVDIFVMGIGSGGTVSGVGRYLKSKNPDV 244 >gb|KVH89058.1| Cysteine synthase/cystathionine beta-synthase P-phosphate-binding site-containing protein [Cynara cardunculus var. scolymus] Length = 343 Score = 67.8 bits (164), Expect = 5e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 KVH E +G IWDDTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 194 KVHFETTGPEIWDDTNGKVDIFVMGIGSGGTVSGVGQYLKSKNPDV 239 >ref|XP_022035773.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial-like [Helianthus annuus] ref|XP_022035774.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial-like [Helianthus annuus] gb|OTG29346.1| putative L-3-cyanoalanine synthase 2 [Helianthus annuus] Length = 362 Score = 67.8 bits (164), Expect = 5e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 KVH E +G IWDDTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 193 KVHFETTGPEIWDDTNGKVDIFVMGIGSGGTVSGVGQYLKSKNPDV 238 >ref|XP_023754250.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial [Lactuca sativa] gb|PLY92715.1| hypothetical protein LSAT_7X4200 [Lactuca sativa] Length = 372 Score = 67.8 bits (164), Expect = 5e-10 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 KVH E +G IWDDTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 203 KVHFETTGPEIWDDTNGKVDIFVMGIGSGGTVSGVGQYLKSKNPDV 248 >gb|KRH74905.1| hypothetical protein GLYMA_01G051100 [Glycine max] Length = 80 Score = 62.4 bits (150), Expect = 1e-09 Identities = 32/68 (47%), Positives = 44/68 (64%) Frame = +3 Query: 246 VHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTRV 425 VH E + IW+DTNG +DIF MGIGS+G + GVG YLKS N +V +Y +E S + + Sbjct: 13 VHFETTWPEIWEDTNGQVDIFVMGIGSDGTVFGVGQYLKSKNPNV---KIYEVEPSESNI 69 Query: 426 WGRATSAV 449 + + AV Sbjct: 70 TTKKSGAV 77 >gb|KZV21808.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial [Dorcoceras hygrometricum] Length = 367 Score = 66.6 bits (161), Expect = 1e-09 Identities = 31/46 (67%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 +VH E +G IWDDTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 201 QVHFETTGPEIWDDTNGKVDIFIMGIGSGGTVSGVGRYLKSQNPDV 246 >ref|XP_003623997.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] gb|AES80215.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] Length = 287 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E S + Sbjct: 118 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNV---KIYGVEPSESN 174 Query: 423 V 425 V Sbjct: 175 V 175 >ref|XP_013449345.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] gb|KEH23373.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] Length = 320 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E S + Sbjct: 151 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNV---KIYGVEPSESN 207 Query: 423 V 425 V Sbjct: 208 V 208 >ref|XP_008343406.2| PREDICTED: L-3-cyanoalanine synthase 2, mitochondrial [Malus domestica] Length = 289 Score = 65.5 bits (158), Expect = 2e-09 Identities = 39/96 (40%), Positives = 53/96 (55%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V + Sbjct: 206 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNV-------------Q 252 Query: 423 VWGRATSAVQVILGKKKYKMDGPDTIVFAGAE*NEL 530 ++G + V+ G K GP +I G + N++ Sbjct: 253 IYGVEPAESNVLNGGK----PGPHSITGNGVDSNQI 284 >ref|NP_001280949.1| L-3-cyanoalanine synthase 1, mitochondrial [Malus domestica] sp|Q1KLZ2.1|CAS1_MALDO RecName: Full=L-3-cyanoalanine synthase 1, mitochondrial; Short=MdCAS1; Flags: Precursor gb|ABF13209.1| beta-cyanoalanine synthase 1 [Malus domestica] Length = 376 Score = 65.9 bits (159), Expect = 2e-09 Identities = 35/74 (47%), Positives = 45/74 (60%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E + + Sbjct: 205 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNV---QIYGVEPAESN 261 Query: 423 VWGRATSAVQVILG 464 V I+G Sbjct: 262 VLNGGKPGPHSIMG 275 >gb|AQZ26214.1| beta-cyanoalanine synthase [Medicago sativa] Length = 379 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E S + Sbjct: 210 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNV---KIYGVEPSESN 266 Query: 423 V 425 V Sbjct: 267 V 267 >ref|XP_003623996.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] gb|AES80214.1| cysteine synthase/L-3-cyanoalanine synthase [Medicago truncatula] Length = 380 Score = 65.9 bits (159), Expect = 2e-09 Identities = 34/61 (55%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E S + Sbjct: 211 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSQNPNV---KIYGVEPSESN 267 Query: 423 V 425 V Sbjct: 268 V 268 >ref|XP_009349262.2| PREDICTED: L-3-cyanoalanine synthase 1, mitochondrial [Pyrus x bretschneideri] Length = 249 Score = 64.7 bits (156), Expect = 3e-09 Identities = 34/74 (45%), Positives = 45/74 (60%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G ++GVG YLKS N +V +Y +E + + Sbjct: 78 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVTGVGQYLKSKNPNV---QIYGVEPAESN 134 Query: 423 VWGRATSAVQVILG 464 V I+G Sbjct: 135 VLNGGKPGPHSIMG 148 >ref|XP_011092647.1| bifunctional L-3-cyanoalanine synthase/cysteine synthase 1, mitochondrial [Sesamum indicum] Length = 372 Score = 65.1 bits (157), Expect = 4e-09 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 +VH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N DV Sbjct: 203 QVHFETTGPEIWEDTNGKVDIFIMGIGSGGTVSGVGQYLKSKNPDV 248 >ref|XP_009367811.1| PREDICTED: L-3-cyanoalanine synthase 2, mitochondrial [Pyrus x bretschneideri] Length = 375 Score = 65.1 bits (157), Expect = 5e-09 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E + + Sbjct: 206 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNV---QIYGVEPAESN 262 Query: 423 V 425 V Sbjct: 263 V 263 >emb|CDP08794.1| unnamed protein product [Coffea canephora] Length = 375 Score = 65.1 bits (157), Expect = 5e-09 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 +VH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N DV +Y +E + + Sbjct: 206 QVHFETTGPEIWEDTNGKVDIFVMGIGSGGTVSGVGQYLKSKNPDV---KIYGVEPTESN 262 Query: 423 V 425 V Sbjct: 263 V 263 >ref|NP_001280751.1| L-3-cyanoalanine synthase 2, mitochondrial [Malus domestica] sp|Q1KLZ1.1|CAS2_MALDO RecName: Full=L-3-cyanoalanine synthase 2, mitochondrial; Short=MdCAS2; Flags: Precursor gb|ABF13210.1| beta-cyanoalanine synthase 2 [Malus domestica] Length = 375 Score = 65.1 bits (157), Expect = 5e-09 Identities = 33/61 (54%), Positives = 42/61 (68%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV*VGHLYMIEISTTR 422 KVH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N +V +Y +E + + Sbjct: 206 KVHFETTGPEIWEDTNGQVDIFVMGIGSGGTVSGVGQYLKSKNPNV---QIYGVEPAESN 262 Query: 423 V 425 V Sbjct: 263 V 263 >gb|PRQ19891.1| putative L-3-cyanoalanine synthase [Rosa chinensis] Length = 169 Score = 62.8 bits (151), Expect = 5e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLD 377 +VH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N D Sbjct: 49 QVHSETAGPEIWEDTNGKVDIFVMGIGSGGTISGVGQYLKSQNPD 93 >dbj|BAD19048.1| beta-cyanoalanine synthase, partial [Diospyros kaki] Length = 214 Score = 63.5 bits (153), Expect = 5e-09 Identities = 30/46 (65%), Positives = 35/46 (76%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLDV 380 +VH E +G IW+DT GT+DIF MGIGS G +SGVG YLKS N DV Sbjct: 45 QVHFETTGPEIWEDTCGTVDIFVMGIGSGGTVSGVGRYLKSQNPDV 90 >gb|PRQ22486.1| L-3-cyanoalanine synthase 1 [Rosa chinensis] Length = 175 Score = 62.8 bits (151), Expect = 6e-09 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +3 Query: 243 KVHLEASGS*IWDDTNGTIDIFFMGIGSEGILSGVGGYLKSTNLD 377 +VH E +G IW+DTNG +DIF MGIGS G +SGVG YLKS N D Sbjct: 103 QVHSETAGPEIWEDTNGKVDIFVMGIGSGGTISGVGQYLKSQNPD 147