BLASTX nr result
ID: Chrysanthemum22_contig00036827
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00036827 (461 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022016924.1| single-stranded DNA-binding protein, mitocho... 56 2e-06 >ref|XP_022016924.1| single-stranded DNA-binding protein, mitochondrial [Helianthus annuus] gb|OTF90667.1| putative nucleic acid-binding, OB-fold-like protein [Helianthus annuus] Length = 223 Score = 55.8 bits (133), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +1 Query: 1 AVRRDGRVVFLQNGGDGQEPYQAELKGVGYY 93 AVR DGRVVFL G DGQEP QAELKGVGYY Sbjct: 193 AVRGDGRVVFLDKGNDGQEPQQAELKGVGYY 223