BLASTX nr result
ID: Chrysanthemum22_contig00036516
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00036516 (733 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022033870.1| protein PAT1 homolog 1-like [Helianthus annu... 75 9e-12 ref|XP_023736546.1| protein PAT1 homolog 1-like [Lactuca sativa]... 71 2e-10 gb|KVI05252.1| hypothetical protein Ccrd_016412 [Cynara carduncu... 70 4e-10 ref|XP_023736882.1| uncharacterized protein LOC111884813 [Lactuc... 69 8e-10 ref|XP_022018181.1| protein PAT1 homolog 1-like [Helianthus annu... 65 2e-08 ref|XP_021999816.1| protein PAT1 homolog 1-like [Helianthus annu... 64 4e-08 ref|XP_012830901.1| PREDICTED: protein PAT1 homolog 1 [Erythrant... 64 8e-08 ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230... 62 2e-07 ref|XP_016438159.1| PREDICTED: protein PAT1 homolog 1-like [Nico... 62 2e-07 ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nico... 62 2e-07 emb|CDP16041.1| unnamed protein product [Coffea canephora] 62 3e-07 ref|XP_017697807.1| PREDICTED: uncharacterized protein LOC108511... 60 3e-07 ref|XP_017701736.1| PREDICTED: uncharacterized protein LOC103721... 60 3e-07 ref|XP_011100381.1| uncharacterized protein LOC105178578 [Sesamu... 62 3e-07 ref|XP_019193695.1| PREDICTED: uncharacterized protein LOC109187... 62 3e-07 ref|XP_016436172.1| PREDICTED: uncharacterized protein LOC107762... 60 5e-07 ref|XP_019194247.1| PREDICTED: uncharacterized protein LOC109188... 61 6e-07 ref|XP_011085449.1| protein PAT1 homolog 1 [Sesamum indicum] 60 8e-07 ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nico... 60 8e-07 ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nico... 60 8e-07 >ref|XP_022033870.1| protein PAT1 homolog 1-like [Helianthus annuus] gb|OTG27371.1| hypothetical protein HannXRQ_Chr04g0099291 [Helianthus annuus] Length = 759 Score = 75.1 bits (183), Expect = 9e-12 Identities = 37/45 (82%), Positives = 39/45 (86%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAGHRGASGPVSPESAR 135 VELLRASLPHTD QRKMLV+FSQRSMQVAGHR SG V+PES R Sbjct: 715 VELLRASLPHTDNKQRKMLVDFSQRSMQVAGHRETSGQVNPESVR 759 >ref|XP_023736546.1| protein PAT1 homolog 1-like [Lactuca sativa] gb|PLY71753.1| hypothetical protein LSAT_3X35281 [Lactuca sativa] Length = 746 Score = 71.2 bits (173), Expect = 2e-10 Identities = 37/48 (77%), Positives = 41/48 (85%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVA---GHRGASGPVSPESAR 135 VELLRASLPHTD+NQRKMLV+FSQRSMQVA GHRG+ G V+ ES R Sbjct: 698 VELLRASLPHTDSNQRKMLVDFSQRSMQVAGLTGHRGSGGQVAQESVR 745 >gb|KVI05252.1| hypothetical protein Ccrd_016412 [Cynara cardunculus var. scolymus] Length = 808 Score = 70.5 bits (171), Expect = 4e-10 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVA---GHRGASGPVSPESAR 135 VELLRASLPHTD NQRKMLV+FSQRSM VA GH+G+ G V+PES R Sbjct: 760 VELLRASLPHTDDNQRKMLVDFSQRSMHVAGFSGHKGSGGQVTPESVR 807 >ref|XP_023736882.1| uncharacterized protein LOC111884813 [Lactuca sativa] gb|PLY71442.1| hypothetical protein LSAT_8X33040 [Lactuca sativa] Length = 758 Score = 69.3 bits (168), Expect = 8e-10 Identities = 36/48 (75%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVA---GHRGASGPVSPESAR 135 VELLRASLPHTD QRKMLV+FSQRSM VA GH+G SG V+PES R Sbjct: 710 VELLRASLPHTDDRQRKMLVDFSQRSMHVAGFNGHKGGSGQVAPESVR 757 >ref|XP_022018181.1| protein PAT1 homolog 1-like [Helianthus annuus] gb|OTF91833.1| putative topoisomerase II-associated protein PAT1 [Helianthus annuus] Length = 756 Score = 65.5 bits (158), Expect = 2e-08 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQV---AGHRGASGPVSPESAR 135 VELLRASLPHTD +Q+KMLV+FSQRSM V +GH+G G V+PES R Sbjct: 708 VELLRASLPHTDDSQKKMLVDFSQRSMHVGGLSGHKGEGGQVAPESVR 755 >ref|XP_021999816.1| protein PAT1 homolog 1-like [Helianthus annuus] gb|OTG00149.1| putative topoisomerase II-associated protein PAT1 [Helianthus annuus] Length = 791 Score = 64.3 bits (155), Expect = 4e-08 Identities = 35/49 (71%), Positives = 39/49 (79%), Gaps = 4/49 (8%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQV---AGHR-GASGPVSPESAR 135 VELLRASLPHTD NQRKMLV+FSQRSM V +GH+ G G V+PES R Sbjct: 742 VELLRASLPHTDDNQRKMLVDFSQRSMHVGGFSGHKGGGGGQVAPESVR 790 >ref|XP_012830901.1| PREDICTED: protein PAT1 homolog 1 [Erythranthe guttata] gb|EYU42843.1| hypothetical protein MIMGU_mgv1a001457mg [Erythranthe guttata] Length = 816 Score = 63.5 bits (153), Expect = 8e-08 Identities = 31/48 (64%), Positives = 39/48 (81%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPESAR 135 VELLRASLPHTD +Q+K+L+NF+QRSM V G H G+SG ++PES R Sbjct: 768 VELLRASLPHTDESQKKLLLNFAQRSMPVTGFNAHGGSSGQINPESVR 815 >ref|XP_009781689.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris] ref|XP_009781690.1| PREDICTED: uncharacterized protein LOC104230555 [Nicotiana sylvestris] ref|XP_016473028.1| PREDICTED: uncharacterized protein LOC107794986 [Nicotiana tabacum] ref|XP_016473029.1| PREDICTED: uncharacterized protein LOC107794986 [Nicotiana tabacum] Length = 814 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHTD +QRK+L+NF+QRSM V G H G+SG ++PES Sbjct: 766 VELLRASLPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPES 811 >ref|XP_016438159.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tabacum] Length = 822 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHTD +QRK+L+NF+QRSM V G H G+SG ++PES Sbjct: 774 VELLRASLPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPES 819 >ref|XP_009594235.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis] ref|XP_018624493.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis] Length = 822 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHTD +QRK+L+NF+QRSM V G H G+SG ++PES Sbjct: 774 VELLRASLPHTDEHQRKLLLNFAQRSMPVTGFNAHGGSSGHINPES 819 >emb|CDP16041.1| unnamed protein product [Coffea canephora] Length = 958 Score = 62.0 bits (149), Expect = 3e-07 Identities = 30/48 (62%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPESAR 135 VELLRASLPHTD QRK+L+NF+QRSM + G H G+SG ++PES + Sbjct: 790 VELLRASLPHTDERQRKLLLNFAQRSMPLTGFNAHGGSSGQINPESVK 837 >ref|XP_017697807.1| PREDICTED: uncharacterized protein LOC108511221 [Phoenix dactylifera] Length = 200 Score = 59.7 bits (143), Expect = 3e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHT+ +QRKML++F+QRSM + G H G SGPV+ ES Sbjct: 152 VELLRASLPHTNEHQRKMLLDFAQRSMPITGFSAHGGGSGPVTSES 197 >ref|XP_017701736.1| PREDICTED: uncharacterized protein LOC103721355 [Phoenix dactylifera] Length = 200 Score = 59.7 bits (143), Expect = 3e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHT+ +QRKML++F+QRSM + G H G SGPV+ ES Sbjct: 152 VELLRASLPHTNEHQRKMLLDFAQRSMPITGFSAHGGGSGPVTSES 197 >ref|XP_011100381.1| uncharacterized protein LOC105178578 [Sesamum indicum] Length = 815 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/48 (62%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPESAR 135 VELLRASLPHTD +Q+K+L+NF+QRSM V G H G+S ++PES R Sbjct: 767 VELLRASLPHTDESQKKLLLNFAQRSMPVTGFNAHSGSSAQINPESVR 814 >ref|XP_019193695.1| PREDICTED: uncharacterized protein LOC109187810 [Ipomoea nil] Length = 819 Score = 61.6 bits (148), Expect = 3e-07 Identities = 30/46 (65%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLR+SLPHT+ NQRK+L+NF+QRSM V G H G+SG ++PES Sbjct: 771 VELLRSSLPHTNENQRKLLLNFAQRSMPVTGFNSHGGSSGQINPES 816 >ref|XP_016436172.1| PREDICTED: uncharacterized protein LOC107762340 [Nicotiana tabacum] Length = 317 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHT+ QRK+L+NF+QRSM V G H G++G +SPES Sbjct: 269 VELLRASLPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPES 314 >ref|XP_019194247.1| PREDICTED: uncharacterized protein LOC109188151 [Ipomoea nil] Length = 817 Score = 60.8 bits (146), Expect = 6e-07 Identities = 29/46 (63%), Positives = 38/46 (82%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLR+S+PHT+ NQRK+L+NF+QRSM V G H G+SG ++PES Sbjct: 769 VELLRSSIPHTNENQRKLLLNFAQRSMPVTGFNSHGGSSGQINPES 814 >ref|XP_011085449.1| protein PAT1 homolog 1 [Sesamum indicum] Length = 812 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/48 (62%), Positives = 37/48 (77%), Gaps = 3/48 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPESAR 135 VELLRAS+PHTD +Q+K+L+NF+QRSM V G H G SG +PES R Sbjct: 764 VELLRASIPHTDESQKKLLLNFAQRSMPVTGFNSHGGNSGQANPESVR 811 >ref|XP_009797313.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana sylvestris] Length = 817 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHT+ QRK+L+NF+QRSM V G H G++G +SPES Sbjct: 769 VELLRASLPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPES 814 >ref|XP_009595696.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis] ref|XP_018624905.1| PREDICTED: protein PAT1 homolog 1-like [Nicotiana tomentosiformis] Length = 817 Score = 60.5 bits (145), Expect = 8e-07 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = +1 Query: 1 VELLRASLPHTDTNQRKMLVNFSQRSMQVAG---HRGASGPVSPES 129 VELLRASLPHT+ QRK+L+NF+QRSM V G H G++G +SPES Sbjct: 769 VELLRASLPHTNEQQRKLLLNFAQRSMPVTGSNAHGGSTGQISPES 814