BLASTX nr result
ID: Chrysanthemum22_contig00036062
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00036062 (519 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023750324.1| zinc finger BED domain-containing protein RI... 141 4e-37 ref|XP_016501746.1| PREDICTED: zinc finger BED domain-containing... 114 2e-29 ref|XP_016488329.1| PREDICTED: zinc finger BED domain-containing... 114 5e-29 ref|XP_016500294.1| PREDICTED: zinc finger BED domain-containing... 112 9e-29 ref|XP_019155820.1| PREDICTED: zinc finger BED domain-containing... 117 6e-28 ref|XP_019150687.1| PREDICTED: zinc finger BED domain-containing... 110 1e-27 ref|XP_019196303.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019161398.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019151050.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019200246.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019190538.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019225842.1| PREDICTED: zinc finger BED domain-containing... 111 2e-27 ref|XP_019150660.1| PREDICTED: zinc finger BED domain-containing... 117 2e-27 ref|XP_019171019.1| PREDICTED: zinc finger BED domain-containing... 117 3e-27 ref|XP_019163642.1| PREDICTED: zinc finger BED domain-containing... 108 3e-27 ref|XP_010675028.2| PREDICTED: zinc finger BED domain-containing... 115 3e-27 ref|XP_021642931.1| zinc finger BED domain-containing protein RI... 117 3e-27 ref|XP_009781566.1| PREDICTED: zinc finger BED domain-containing... 111 3e-27 ref|XP_019169717.1| PREDICTED: zinc finger BED domain-containing... 117 4e-27 ref|XP_019199775.1| PREDICTED: zinc finger BED domain-containing... 114 4e-27 >ref|XP_023750324.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Lactuca sativa] Length = 399 Score = 141 bits (355), Expect = 4e-37 Identities = 71/96 (73%), Positives = 81/96 (84%) Frame = +3 Query: 3 KNEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLR 182 KN+ RFPVIAA+ARD+LAIPASTVASES+FSTG RVLDAF SSLTP VEALIC QNWLR Sbjct: 262 KNQVRFPVIAAIARDVLAIPASTVASESSFSTGRRVLDAFCSSLTPKTVEALICCQNWLR 321 Query: 183 SKSVPFDIEEKLDDLERFEADMKDLPHAMSTLTVDD 290 SK+VP DIEE + LE +EA++KDLP A+S LT D Sbjct: 322 SKNVPIDIEESFEALENYEAEVKDLPQAISALTFFD 357 >ref|XP_016501746.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tabacum] Length = 148 Score = 114 bits (286), Expect = 2e-29 Identities = 56/90 (62%), Positives = 68/90 (75%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP++A MARD+LAIP S+VASESAFSTGGR+LD FR SLTP +VE L+C Q+WLRS Sbjct: 55 NSPRFPILAKMARDVLAIPISSVASESAFSTGGRILDQFRGSLTPKLVETLVCLQDWLRS 114 Query: 186 KSVPFDIEEKLDDLERFEADMKDLPHAMST 275 +S+P ++EE LD LE E D L ST Sbjct: 115 ESLPVNVEEDLDFLETLEEDFTHLGKEAST 144 >ref|XP_016488329.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tabacum] ref|XP_016488398.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tabacum] Length = 178 Score = 114 bits (286), Expect = 5e-29 Identities = 53/83 (63%), Positives = 69/83 (83%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 NE RFP++A MARD+LAIP S+VASE AFSTGGR+LD+FRSSLTP +V++LIC Q+WLRS Sbjct: 86 NEPRFPILAEMARDVLAIPISSVASECAFSTGGRILDSFRSSLTPKLVQSLICLQDWLRS 145 Query: 186 KSVPFDIEEKLDDLERFEADMKD 254 + +P +EE L+ LE+ E D+ D Sbjct: 146 EPIPIKVEEDLEYLEQLELDLAD 168 >ref|XP_016500294.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Nicotiana tabacum] Length = 139 Score = 112 bits (281), Expect = 9e-29 Identities = 52/81 (64%), Positives = 68/81 (83%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 NE RFP++A MARD+LAIP S+VASE AFSTGGR+LD+FRSSLTP +V++LIC Q+WLRS Sbjct: 47 NEPRFPILAEMARDVLAIPISSVASECAFSTGGRILDSFRSSLTPKLVQSLICLQDWLRS 106 Query: 186 KSVPFDIEEKLDDLERFEADM 248 + +P +EE L+ LE+ E D+ Sbjct: 107 EPIPIKVEEDLEYLEQLELDL 127 >ref|XP_019155820.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 421 Score = 117 bits (293), Expect = 6e-28 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 311 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRM 370 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 371 QNTPLCIEENLEELERFEKEL 391 >ref|XP_019150687.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 3-like [Ipomoea nil] Length = 139 Score = 110 bits (274), Expect = 1e-27 Identities = 51/81 (62%), Positives = 66/81 (81%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP+++ MARD+LA+P STVASESAFST RVLDA RSSLTP +VEAL+C+Q+WLR+ Sbjct: 37 NSDRFPILSKMARDVLAVPISTVASESAFSTSDRVLDAIRSSLTPKIVEALVCAQDWLRA 96 Query: 186 KSVPFDIEEKLDDLERFEADM 248 + P +EE LDD+ER E ++ Sbjct: 97 PNHPIFVEENLDDVERLENEL 117 >ref|XP_019196303.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 664 Score = 117 bits (294), Expect = 2e-27 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 562 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 621 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 622 QNTPLCIEENLEELERFEKEL 642 >ref|XP_019161398.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 668 Score = 117 bits (294), Expect = 2e-27 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 567 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 626 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 627 QNTPLCIEENLEELERFEKEL 647 >ref|XP_019151050.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 734 Score = 117 bits (294), Expect = 2e-27 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 614 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 673 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 674 QNTPLCIEENLEELERFEKEL 694 >ref|XP_019200246.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 734 Score = 117 bits (294), Expect = 2e-27 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 614 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 673 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 674 QNTPLCIEENLEELERFEKEL 694 >ref|XP_019190538.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 739 Score = 117 bits (294), Expect = 2e-27 Identities = 55/81 (67%), Positives = 69/81 (85%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 619 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 678 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 679 QNTPLCIEENLEELERFEKEL 699 >ref|XP_019225842.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like [Nicotiana attenuata] Length = 222 Score = 111 bits (278), Expect = 2e-27 Identities = 55/90 (61%), Positives = 68/90 (75%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP++A MARD L IP S+VAS+SAFSTGGR+LD FRSSLTP +VE L+C Q+WLRS Sbjct: 129 NSPRFPILAKMARDELVIPISSVASKSAFSTGGRILDQFRSSLTPKLVETLVCLQDWLRS 188 Query: 186 KSVPFDIEEKLDDLERFEADMKDLPHAMST 275 +S+P ++EE LD LE E D +L ST Sbjct: 189 ESLPVNVEEDLDFLETLEEDFTNLGKEAST 218 >ref|XP_019150660.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 657 Score = 117 bits (293), Expect = 2e-27 Identities = 55/81 (67%), Positives = 68/81 (83%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C Q+WLR Sbjct: 522 NSARFPVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCKQDWLRK 581 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE ++ Sbjct: 582 QNTPLCIEENLEELERFEKEL 602 >ref|XP_019171019.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 696 Score = 117 bits (293), Expect = 3e-27 Identities = 56/81 (69%), Positives = 68/81 (83%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARF V++ +ARD+LAIP STVASESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 614 NSARFSVLSKLARDVLAIPISTVASESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 673 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L++LERFE DM Sbjct: 674 QNTPLCIEENLEELERFEKDM 694 >ref|XP_019163642.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 123 Score = 108 bits (270), Expect = 3e-27 Identities = 50/81 (61%), Positives = 63/81 (77%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP ++ MARD+LA+P STV SESAFST GRVLDAFRS LTP +VEAL+C Q+WLR Sbjct: 16 NSERFPTLSKMARDVLAVPISTVVSESAFSTSGRVLDAFRSFLTPKIVEALVCEQDWLRL 75 Query: 186 KSVPFDIEEKLDDLERFEADM 248 + P I+E +DD+ER E ++ Sbjct: 76 PNQPVHIDENIDDVERLEQEL 96 >ref|XP_010675028.2| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Beta vulgaris subsp. vulgaris] Length = 443 Score = 115 bits (289), Expect = 3e-27 Identities = 54/94 (57%), Positives = 75/94 (79%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N +RFP ++ +ARD+LAIP STVASESAFSTGGRVLD FRSSLTP +VEAL+C Q+WLR+ Sbjct: 352 NTSRFPTLSLIARDVLAIPVSTVASESAFSTGGRVLDPFRSSLTPKIVEALVCGQDWLRA 411 Query: 186 KSVPFDIEEKLDDLERFEADMKDLPHAMSTLTVD 287 P D+EEK++++E+ E+D+ + A S + ++ Sbjct: 412 S--PVDVEEKMEEIEKLESDISKISLAPSLIDIE 443 >ref|XP_021642931.1| zinc finger BED domain-containing protein RICESLEEPER 2-like [Hevea brasiliensis] Length = 858 Score = 117 bits (293), Expect = 3e-27 Identities = 59/90 (65%), Positives = 71/90 (78%), Gaps = 1/90 (1%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP++ MARDILA+P STVASE+AFSTGGRVLD FRSSLTP +VEALIC+Q+W RS Sbjct: 738 NSERFPILGKMARDILAVPVSTVASENAFSTGGRVLDPFRSSLTPRIVEALICAQDWTRS 797 Query: 186 KSVPFDIEEKLDDLERF-EADMKDLPHAMS 272 + P +IEE L++LE+F E K LP A S Sbjct: 798 SNCPINIEEDLEELEKFEEGSQKLLPVASS 827 >ref|XP_009781566.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 1-like [Nicotiana sylvestris] Length = 232 Score = 111 bits (278), Expect = 3e-27 Identities = 55/82 (67%), Positives = 68/82 (82%), Gaps = 1/82 (1%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N RFP +A MARD+LAIP S+VASESAFSTGGR+LD FRSSLTP +V+AL+C Q+WLR+ Sbjct: 139 NSPRFPALAEMARDVLAIPISSVASESAFSTGGRILDPFRSSLTPRLVQALVCVQDWLRN 198 Query: 186 KS-VPFDIEEKLDDLERFEADM 248 +S P IEE LD+LE+ EAD+ Sbjct: 199 ESTTPVKIEEDLDNLEQLEADL 220 >ref|XP_019169717.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 684 Score = 117 bits (292), Expect = 4e-27 Identities = 55/81 (67%), Positives = 68/81 (83%) Frame = +3 Query: 6 NEARFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRS 185 N ARFPV++ +ARD+LAIP STVA ESAFST GRVLD FRSSLTP +VEAL+C+Q+WLR Sbjct: 582 NSARFPVLSKLARDVLAIPISTVALESAFSTSGRVLDPFRSSLTPKIVEALVCTQDWLRK 641 Query: 186 KSVPFDIEEKLDDLERFEADM 248 ++ P IEE L+DLERFE ++ Sbjct: 642 QNTPLCIEENLEDLERFEKEL 662 >ref|XP_019199775.1| PREDICTED: zinc finger BED domain-containing protein RICESLEEPER 2-like [Ipomoea nil] Length = 364 Score = 114 bits (285), Expect = 4e-27 Identities = 54/78 (69%), Positives = 65/78 (83%) Frame = +3 Query: 15 RFPVIAAMARDILAIPASTVASESAFSTGGRVLDAFRSSLTPTVVEALICSQNWLRSKSV 194 RFPV++ MARDILA+P STVASES FST GRVLDAFRSSLTP +VEAL+C+Q+WLR + Sbjct: 243 RFPVLSKMARDILAVPISTVASESTFSTSGRVLDAFRSSLTPRIVEALVCAQDWLRLSNQ 302 Query: 195 PFDIEEKLDDLERFEADM 248 P IEE LDD+ER E ++ Sbjct: 303 PISIEENLDDVERIEKEL 320