BLASTX nr result
ID: Chrysanthemum22_contig00035870
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00035870 (391 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK45729.1| unknown [Medicago truncatula] >gi|388522081|gb|AF... 52 4e-06 dbj|GAU21047.1| hypothetical protein TSUD_132590 [Trifolium subt... 55 4e-06 ref|XP_013459438.1| vacuolar protein sorting-associated protein ... 54 8e-06 >gb|AFK45729.1| unknown [Medicago truncatula] gb|AFK49102.1| unknown [Medicago truncatula] Length = 95 Score = 52.0 bits (123), Expect = 4e-06 Identities = 24/33 (72%), Positives = 27/33 (81%) Frame = -3 Query: 125 ELIPIRLFLNPHELVTTTHNIDNKLSVNYFLNL 27 E IPIRLFL+P+EL T HNI+NK SV YFLNL Sbjct: 38 ESIPIRLFLSPYELTPTHHNINNKFSVKYFLNL 70 >dbj|GAU21047.1| hypothetical protein TSUD_132590 [Trifolium subterraneum] Length = 300 Score = 54.7 bits (130), Expect = 4e-06 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = -3 Query: 155 KLTSRVLLARELIPIRLFLNPHELVTTTHNIDNKLSVNYFLNL 27 +L V + E IPIRLFLNP+EL T HNI+NK SV YFLNL Sbjct: 233 ELMDGVPIRGESIPIRLFLNPYELTPTYHNINNKFSVKYFLNL 275 >ref|XP_013459438.1| vacuolar protein sorting-associated protein 26A [Medicago truncatula] gb|KEH33469.1| vacuolar protein sorting-associated protein 26A [Medicago truncatula] Length = 301 Score = 53.9 bits (128), Expect = 8e-06 Identities = 26/43 (60%), Positives = 31/43 (72%) Frame = -3 Query: 155 KLTSRVLLARELIPIRLFLNPHELVTTTHNIDNKLSVNYFLNL 27 +L V + E IP+RLFLNP+EL T HNI+NK SV YFLNL Sbjct: 234 ELMDGVPVRGESIPVRLFLNPYELTPTYHNINNKFSVKYFLNL 276