BLASTX nr result
ID: Chrysanthemum22_contig00035635
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00035635 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022022129.1| F-box/FBD/LRR-repeat protein At1g78750-like ... 57 7e-07 >ref|XP_022022129.1| F-box/FBD/LRR-repeat protein At1g78750-like [Helianthus annuus] Length = 424 Score = 57.4 bits (137), Expect = 7e-07 Identities = 31/60 (51%), Positives = 40/60 (66%) Frame = -1 Query: 408 MLMNLKTIKYTETRGYDLNIEFLKYMLGNLKVLTGLTITCDTMFSEKEEECMRAKLSMFP 229 ML NL TIK + +G I+FL+YMLGN KVL +TITC+ +++ KEE RAKL P Sbjct: 354 MLTNLTTIKISSCKGQTHEIKFLEYMLGNAKVLKTVTITCE-IYAIKEENWFRAKLLKLP 412