BLASTX nr result
ID: Chrysanthemum22_contig00035361
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00035361 (382 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93933.1| hypothetical protein Ccrd_004011 [Cynara carduncu... 56 4e-17 ref|XP_022035068.1| BTB/POZ domain-containing protein At5g03250-... 58 4e-16 ref|XP_021994642.1| BTB/POZ domain-containing protein At5g03250-... 51 2e-15 gb|OTG09178.1| putative SKP1/BTB/POZ domain, NPH3 domain protein... 51 2e-15 ref|XP_023767821.1| BTB/POZ domain-containing protein At5g03250-... 60 3e-15 gb|OTF99236.1| putative SKP1/BTB/POZ domain, NPH3 domain protein... 58 4e-15 ref|XP_022007092.1| BTB/POZ domain-containing protein At5g03250-... 58 4e-15 gb|KVH99951.1| BTB/POZ-like protein [Cynara cardunculus var. sco... 50 4e-14 ref|XP_019254746.1| PREDICTED: BTB/POZ domain-containing protein... 44 3e-13 ref|XP_016470393.1| PREDICTED: BTB/POZ domain-containing protein... 43 5e-13 ref|XP_017246665.1| PREDICTED: BTB/POZ domain-containing protein... 45 8e-13 ref|XP_016495619.1| PREDICTED: BTB/POZ domain-containing protein... 43 1e-12 ref|XP_009605934.1| PREDICTED: BTB/POZ domain-containing protein... 43 1e-12 ref|XP_022861147.1| BTB/POZ domain-containing protein At5g03250-... 43 2e-12 ref|XP_006363693.1| PREDICTED: BTB/POZ domain-containing protein... 45 2e-12 ref|XP_009781651.1| PREDICTED: BTB/POZ domain-containing protein... 40 3e-12 ref|XP_022883284.1| BTB/POZ domain-containing protein At5g03250-... 42 4e-12 ref|XP_015086824.1| PREDICTED: BTB/POZ domain-containing protein... 45 4e-12 gb|PHT70646.1| BTB/POZ domain-containing protein [Capsicum annuum] 47 8e-12 gb|PHT36458.1| BTB/POZ domain-containing protein [Capsicum bacca... 47 8e-12 >gb|KVH93933.1| hypothetical protein Ccrd_004011 [Cynara cardunculus var. scolymus] Length = 572 Score = 48.5 bits (114), Expect(3) = 4e-17 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 VHLN+IPGG K FELIAKFCY V L+++ +++ Sbjct: 70 VHLNDIPGGVKAFELIAKFCYGVKLEITSHNVISL 104 Score = 47.0 bits (110), Expect(3) = 4e-17 Identities = 22/30 (73%), Positives = 23/30 (76%) Frame = -3 Query: 359 KLSQSKRQCTSGLSSDVTIEIGETTFNLHK 270 +L QCTSGL SDVTIEIGET FNLHK Sbjct: 14 RLEDHTWQCTSGLPSDVTIEIGETAFNLHK 43 Score = 39.7 bits (91), Expect(3) = 4e-17 Identities = 18/27 (66%), Positives = 24/27 (88%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLI+RSGLLTKL+GDN N+DG + C++ Sbjct: 45 PLIARSGLLTKLIGDNPNEDG-LACVV 70 Score = 56.2 bits (134), Expect = 1e-06 Identities = 28/42 (66%), Positives = 31/42 (73%) Frame = -1 Query: 151 IAKFCYDVNLKLSKFQSLAVAVPNYARPQSDVIYHAIDILSK 26 +A DVNLK KFQSLAVAVP+YARP SD IY A+DI K Sbjct: 407 LADVAADVNLKFPKFQSLAVAVPDYARPHSDGIYRAVDIYLK 448 >ref|XP_022035068.1| BTB/POZ domain-containing protein At5g03250-like [Helianthus annuus] gb|OTG36781.1| putative SKP1/BTB/POZ domain, NPH3 domain protein [Helianthus annuus] Length = 562 Score = 52.0 bits (123), Expect(3) = 4e-16 Identities = 21/35 (60%), Positives = 29/35 (82%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 +HLN+IPGGAK FELIAKFCYDV L+++ +++ Sbjct: 70 IHLNDIPGGAKVFELIAKFCYDVKLEVTSHNVISL 104 Score = 40.8 bits (94), Expect(3) = 4e-16 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 359 KLSQSKRQCTSGLSSDVTIEIGETTFNLHK 270 +L QC GL SDVTIEIG T+FNLHK Sbjct: 14 RLDDHTWQCIGGLPSDVTIEIGGTSFNLHK 43 Score = 38.9 bits (89), Expect(3) = 4e-16 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCI 190 PLISRSGLL+KL+GD+ N+DG + I Sbjct: 45 PLISRSGLLSKLIGDSPNEDGPICAI 70 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 151 IAKFCYDVNLKLSKFQSLAVAVPNYARPQSDVIYHAIDILSK 26 +A DVNLKLSKFQS+A VP+YARPQSD IY AIDI K Sbjct: 393 LADVAADVNLKLSKFQSVAAGVPDYARPQSDGIYRAIDIFLK 434 >ref|XP_021994642.1| BTB/POZ domain-containing protein At5g03250-like [Helianthus annuus] Length = 604 Score = 50.8 bits (120), Expect(3) = 2e-15 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 VHL+EIPGG+KTFELIA+FCYD+ ++L+ Sbjct: 71 VHLDEIPGGSKTFELIARFCYDIKMELT 98 Score = 43.5 bits (101), Expect(3) = 2e-15 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 338 QCTSGLSSDVTIEIGETTFNLHK 270 QCTSGL DVTIEIGET+F+LHK Sbjct: 22 QCTSGLPGDVTIEIGETSFHLHK 44 Score = 35.0 bits (79), Expect(3) = 2e-15 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLLT+L+GD N+D V CI+ Sbjct: 46 PLISRSGLLTRLIGDFSNEDEHV-CIV 71 >gb|OTG09178.1| putative SKP1/BTB/POZ domain, NPH3 domain protein [Helianthus annuus] Length = 571 Score = 50.8 bits (120), Expect(3) = 2e-15 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 VHL+EIPGG+KTFELIA+FCYD+ ++L+ Sbjct: 71 VHLDEIPGGSKTFELIARFCYDIKMELT 98 Score = 43.5 bits (101), Expect(3) = 2e-15 Identities = 19/23 (82%), Positives = 21/23 (91%) Frame = -3 Query: 338 QCTSGLSSDVTIEIGETTFNLHK 270 QCTSGL DVTIEIGET+F+LHK Sbjct: 22 QCTSGLPGDVTIEIGETSFHLHK 44 Score = 35.0 bits (79), Expect(3) = 2e-15 Identities = 18/27 (66%), Positives = 22/27 (81%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLLT+L+GD N+D V CI+ Sbjct: 46 PLISRSGLLTRLIGDFSNEDEHV-CIV 71 >ref|XP_023767821.1| BTB/POZ domain-containing protein At5g03250-like [Lactuca sativa] gb|PLY82593.1| hypothetical protein LSAT_2X109100 [Lactuca sativa] Length = 583 Score = 49.3 bits (116), Expect(3) = 3e-15 Identities = 20/35 (57%), Positives = 27/35 (77%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 VHLN+IPGG K FELIAKFCY + L+L+ +++ Sbjct: 70 VHLNDIPGGCKAFELIAKFCYSIKLELTSHNVISL 104 Score = 46.2 bits (108), Expect(3) = 3e-15 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -3 Query: 359 KLSQSKRQCTSGLSSDVTIEIGETTFNLHK 270 +L QCTSGL SD+TIEIGET+FNLHK Sbjct: 14 RLEDHTWQCTSGLPSDLTIEIGETSFNLHK 43 Score = 33.5 bits (75), Expect(3) = 3e-15 Identities = 15/26 (57%), Positives = 19/26 (73%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCI 190 PLISRS LL KL+GDN ++D V + Sbjct: 45 PLISRSALLAKLIGDNPDEDAPVCSV 70 Score = 60.1 bits (144), Expect = 6e-08 Identities = 29/36 (80%), Positives = 32/36 (88%) Frame = -1 Query: 133 DVNLKLSKFQSLAVAVPNYARPQSDVIYHAIDILSK 26 DVN+KLSKFQSLAVAVP+YARPQSD IY A+DI K Sbjct: 415 DVNMKLSKFQSLAVAVPDYARPQSDGIYRALDIFLK 450 >gb|OTF99236.1| putative SKP1/BTB/POZ domain, NPH3 domain protein [Helianthus annuus] Length = 580 Score = 50.8 bits (120), Expect(3) = 4e-15 Identities = 20/35 (57%), Positives = 29/35 (82%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 +HLN+IPGGAK FELIA+FCYDV L+++ +++ Sbjct: 71 IHLNDIPGGAKVFELIARFCYDVKLEVTSHNVISL 105 Score = 40.8 bits (94), Expect(3) = 4e-15 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 359 KLSQSKRQCTSGLSSDVTIEIGETTFNLHK 270 +L QC GL SDVTIEIG T+FNLHK Sbjct: 14 RLDDHTWQCIGGLPSDVTIEIGGTSFNLHK 43 Score = 36.6 bits (83), Expect(3) = 4e-15 Identities = 18/27 (66%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNY-NDDGSVLCI 190 PLISRSGLL+KL+GDN N+DG + I Sbjct: 45 PLISRSGLLSKLIGDNSPNEDGPICAI 71 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 151 IAKFCYDVNLKLSKFQSLAVAVPNYARPQSDVIYHAIDILSK 26 +A DVNLKLSKFQS+A VP+YARPQSD IY AIDI K Sbjct: 386 LADVAADVNLKLSKFQSVAAGVPDYARPQSDGIYRAIDIFLK 427 >ref|XP_022007092.1| BTB/POZ domain-containing protein At5g03250-like [Helianthus annuus] Length = 556 Score = 50.8 bits (120), Expect(3) = 4e-15 Identities = 20/35 (57%), Positives = 29/35 (82%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 +HLN+IPGGAK FELIA+FCYDV L+++ +++ Sbjct: 71 IHLNDIPGGAKVFELIARFCYDVKLEVTSHNVISL 105 Score = 40.8 bits (94), Expect(3) = 4e-15 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = -3 Query: 359 KLSQSKRQCTSGLSSDVTIEIGETTFNLHK 270 +L QC GL SDVTIEIG T+FNLHK Sbjct: 14 RLDDHTWQCIGGLPSDVTIEIGGTSFNLHK 43 Score = 36.6 bits (83), Expect(3) = 4e-15 Identities = 18/27 (66%), Positives = 22/27 (81%), Gaps = 1/27 (3%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNY-NDDGSVLCI 190 PLISRSGLL+KL+GDN N+DG + I Sbjct: 45 PLISRSGLLSKLIGDNSPNEDGPICAI 71 Score = 58.2 bits (139), Expect = 3e-07 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -1 Query: 151 IAKFCYDVNLKLSKFQSLAVAVPNYARPQSDVIYHAIDILSK 26 +A DVNLKLSKFQS+A VP+YARPQSD IY AIDI K Sbjct: 386 LADVAADVNLKLSKFQSVAAGVPDYARPQSDGIYRAIDIFLK 427 >gb|KVH99951.1| BTB/POZ-like protein [Cynara cardunculus var. scolymus] Length = 604 Score = 50.1 bits (118), Expect(3) = 4e-14 Identities = 20/28 (71%), Positives = 27/28 (96%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 VHL+EIPGG+KTFELIA+FCYDV ++++ Sbjct: 94 VHLDEIPGGSKTFELIARFCYDVKIEVT 121 Score = 41.2 bits (95), Expect(3) = 4e-14 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -3 Query: 338 QCTSGLSSDVTIEIGETTFNLHK 270 QCTSGL SD TIEIGE +F+LHK Sbjct: 45 QCTSGLPSDATIEIGEMSFHLHK 67 Score = 33.9 bits (76), Expect(3) = 4e-14 Identities = 15/26 (57%), Positives = 20/26 (76%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCI 190 PLI+RSGL+TKL+GD N+D V + Sbjct: 69 PLITRSGLMTKLIGDLSNEDEHVCVV 94 >ref|XP_019254746.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Nicotiana attenuata] gb|OIS98058.1| btbpoz domain-containing protein [Nicotiana attenuata] Length = 608 Score = 43.9 bits (102), Expect(3) = 3e-13 Identities = 18/28 (64%), Positives = 24/28 (85%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + L++IPGGAK FEL+AKFCY V L+L+ Sbjct: 70 LQLSDIPGGAKAFELVAKFCYGVKLELT 97 Score = 39.7 bits (91), Expect(3) = 3e-13 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 38.5 bits (88), Expect(3) = 3e-13 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLL KL+ ++ NDDGSV C+L Sbjct: 45 PLISRSGLLAKLIKESSNDDGSV-CVL 70 >ref|XP_016470393.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Nicotiana tabacum] Length = 608 Score = 43.1 bits (100), Expect(3) = 5e-13 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + L++IPGGAK FEL+AKFCY V ++L+ Sbjct: 70 LQLSDIPGGAKAFELVAKFCYGVKIELT 97 Score = 39.7 bits (91), Expect(3) = 5e-13 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 38.5 bits (88), Expect(3) = 5e-13 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLL KL+ ++ NDDGSV C+L Sbjct: 45 PLISRSGLLAKLIKESSNDDGSV-CVL 70 >ref|XP_017246665.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Daucus carota subsp. sativus] gb|KZM99880.1| hypothetical protein DCAR_012758 [Daucus carota subsp. sativus] Length = 570 Score = 44.7 bits (104), Expect(3) = 8e-13 Identities = 20/52 (38%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = -1 Query: 205 IRFVHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV-AVPNYARPQSDVI 53 ++ + L ++PGGAKTFELIAKFCY V ++L+ + V ++ + D++ Sbjct: 67 VQVLQLCDLPGGAKTFELIAKFCYGVKIELTASNIVTVRCAADFLQMNEDIV 118 Score = 42.7 bits (99), Expect(3) = 8e-13 Identities = 19/31 (61%), Positives = 23/31 (74%) Frame = -3 Query: 338 QCTSGLSSDVTIEIGETTFNLHKIRSFQEVG 246 QCTSGL SDVT+EIGE +F+LHK + G Sbjct: 21 QCTSGLPSDVTVEIGEMSFHLHKFPLLSKSG 51 Score = 33.1 bits (74), Expect(3) = 8e-13 Identities = 14/23 (60%), Positives = 19/23 (82%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSV 199 PL+S+SGLL K +G+ +DDGSV Sbjct: 45 PLLSKSGLLAKQIGEQPSDDGSV 67 >ref|XP_016495619.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Nicotiana tabacum] Length = 607 Score = 43.1 bits (100), Expect(3) = 1e-12 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + L++IPGGAK FEL+AKFCY V ++L+ Sbjct: 70 LQLSDIPGGAKAFELVAKFCYGVKIELT 97 Score = 38.5 bits (88), Expect(3) = 1e-12 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE F LHK Sbjct: 22 CTSGLPSDVTIEIGEMFFYLHK 43 Score = 38.5 bits (88), Expect(3) = 1e-12 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLL KL+ ++ NDDGSV C+L Sbjct: 45 PLISRSGLLAKLIKESSNDDGSV-CVL 70 >ref|XP_009605934.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Nicotiana tomentosiformis] Length = 607 Score = 43.1 bits (100), Expect(3) = 1e-12 Identities = 17/28 (60%), Positives = 24/28 (85%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + L++IPGGAK FEL+AKFCY V ++L+ Sbjct: 70 LQLSDIPGGAKAFELVAKFCYGVKIELT 97 Score = 38.5 bits (88), Expect(3) = 1e-12 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE F LHK Sbjct: 22 CTSGLPSDVTIEIGEMFFYLHK 43 Score = 38.1 bits (87), Expect(3) = 1e-12 Identities = 19/27 (70%), Positives = 22/27 (81%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLL KL+ + NDDGSV C+L Sbjct: 45 PLISRSGLLAKLIKETSNDDGSV-CVL 70 >ref|XP_022861147.1| BTB/POZ domain-containing protein At5g03250-like [Olea europaea var. sylvestris] Length = 589 Score = 43.1 bits (100), Expect(3) = 2e-12 Identities = 16/35 (45%), Positives = 27/35 (77%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 + L+++PGG KTFEL+AKFCY V ++L+ +++ Sbjct: 82 LQLDQLPGGTKTFELVAKFCYGVKIELTSMNVVSL 116 Score = 41.2 bits (95), Expect(3) = 2e-12 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F+LHK Sbjct: 34 CTSGLQSDVTIEIGEMSFHLHK 55 Score = 35.0 bits (79), Expect(3) = 2e-12 Identities = 15/23 (65%), Positives = 21/23 (91%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSV 199 PL+SRSGLL KL+G++++ DGSV Sbjct: 57 PLLSRSGLLEKLIGESHSIDGSV 79 >ref|XP_006363693.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Solanum tuberosum] Length = 610 Score = 44.7 bits (104), Expect(3) = 2e-12 Identities = 17/31 (54%), Positives = 25/31 (80%) Frame = -1 Query: 205 IRFVHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + + LN+IPGGAK FEL+AKFCY V ++++ Sbjct: 67 VSVLQLNDIPGGAKAFELVAKFCYGVKIEIT 97 Score = 39.7 bits (91), Expect(3) = 2e-12 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 34.7 bits (78), Expect(3) = 2e-12 Identities = 17/23 (73%), Positives = 19/23 (82%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSV 199 PLISRSGLL KL+ D+ NDD SV Sbjct: 45 PLISRSGLLAKLVKDSSNDDVSV 67 >ref|XP_009781651.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Nicotiana sylvestris] Length = 608 Score = 40.4 bits (93), Expect(3) = 3e-12 Identities = 16/28 (57%), Positives = 23/28 (82%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + L++IPGGAK FE +AKFCY V ++L+ Sbjct: 70 LQLSDIPGGAKAFEPVAKFCYGVKIELT 97 Score = 39.7 bits (91), Expect(3) = 3e-12 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 38.5 bits (88), Expect(3) = 3e-12 Identities = 19/27 (70%), Positives = 23/27 (85%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PLISRSGLL KL+ ++ NDDGSV C+L Sbjct: 45 PLISRSGLLAKLIKESSNDDGSV-CVL 70 >ref|XP_022883284.1| BTB/POZ domain-containing protein At5g03250-like [Olea europaea var. sylvestris] Length = 599 Score = 42.4 bits (98), Expect(3) = 4e-12 Identities = 16/35 (45%), Positives = 26/35 (74%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 + L ++PGGAK FEL+AKFCY V ++L+ +++ Sbjct: 70 LQLGQLPGGAKAFELVAKFCYGVKIELTSMNVVSL 104 Score = 41.2 bits (95), Expect(3) = 4e-12 Identities = 18/22 (81%), Positives = 20/22 (90%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F+LHK Sbjct: 22 CTSGLQSDVTIEIGEMSFHLHK 43 Score = 34.7 bits (78), Expect(3) = 4e-12 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCILMKYL 175 PL+SRSGLL KL+G++ + DGSV + + L Sbjct: 45 PLLSRSGLLEKLIGESQSVDGSVCALQLGQL 75 >ref|XP_015086824.1| PREDICTED: BTB/POZ domain-containing protein At5g03250-like [Solanum pennellii] Length = 597 Score = 45.4 bits (106), Expect(3) = 4e-12 Identities = 19/35 (54%), Positives = 26/35 (74%) Frame = -1 Query: 196 VHLNEIPGGAKTFELIAKFCYDVNLKLSKFQSLAV 92 + L+EIPGGAK FEL+AKFCY V +L+ +A+ Sbjct: 71 IQLSEIPGGAKAFELVAKFCYGVRFELTPLNVVAL 105 Score = 37.4 bits (85), Expect(3) = 4e-12 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -3 Query: 338 QCTSGLSSDVTIEIGETTFNLHK 270 +C SGL SD+TIEIGE +F LHK Sbjct: 21 RCKSGLPSDITIEIGEMSFYLHK 43 Score = 35.4 bits (80), Expect(3) = 4e-12 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSVLCIL 187 PL+SRSGLL KL+ D+ DD LC++ Sbjct: 45 PLLSRSGLLEKLMNDSRKDDDISLCVI 71 >gb|PHT70646.1| BTB/POZ domain-containing protein [Capsicum annuum] Length = 611 Score = 46.6 bits (109), Expect(3) = 8e-12 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -1 Query: 205 IRFVHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + + LN+IPGGAK FEL+AKFCY V ++LS Sbjct: 67 VSVLQLNDIPGGAKAFELVAKFCYGVKIELS 97 Score = 39.7 bits (91), Expect(3) = 8e-12 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 30.8 bits (68), Expect(3) = 8e-12 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSV 199 PLISRSG L L+ ++ ND+GSV Sbjct: 45 PLISRSGRLATLIKESCNDEGSV 67 >gb|PHT36458.1| BTB/POZ domain-containing protein [Capsicum baccatum] Length = 611 Score = 46.6 bits (109), Expect(3) = 8e-12 Identities = 19/31 (61%), Positives = 25/31 (80%) Frame = -1 Query: 205 IRFVHLNEIPGGAKTFELIAKFCYDVNLKLS 113 + + LN+IPGGAK FEL+AKFCY V ++LS Sbjct: 67 VSVLQLNDIPGGAKAFELVAKFCYGVKIELS 97 Score = 39.7 bits (91), Expect(3) = 8e-12 Identities = 18/22 (81%), Positives = 19/22 (86%) Frame = -3 Query: 335 CTSGLSSDVTIEIGETTFNLHK 270 CTSGL SDVTIEIGE +F LHK Sbjct: 22 CTSGLPSDVTIEIGEMSFYLHK 43 Score = 30.8 bits (68), Expect(3) = 8e-12 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 267 PLISRSGLLTKLLGDNYNDDGSV 199 PLISRSG L L+ ++ ND+GSV Sbjct: 45 PLISRSGRLATLIKESCNDEGSV 67