BLASTX nr result
ID: Chrysanthemum22_contig00035359
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00035359 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021996607.1| probable ubiquitin-conjugating enzyme E2 37 ... 44 1e-07 gb|KVH93910.1| Ubiquitin-conjugating enzyme, active site-contain... 40 3e-06 >ref|XP_021996607.1| probable ubiquitin-conjugating enzyme E2 37 [Helianthus annuus] gb|OTG03819.1| putative ubiquitin-conjugating enzyme/RWD-like protein [Helianthus annuus] Length = 456 Score = 43.5 bits (101), Expect(2) = 1e-07 Identities = 19/30 (63%), Positives = 26/30 (86%) Frame = -3 Query: 118 FDQKAHSMT*KYAKIDASPSHGGLQSLTDS 29 FDQKA SMT K+A+ D+SP++GG+Q +TDS Sbjct: 150 FDQKARSMTEKFARSDSSPNNGGIQFVTDS 179 Score = 39.7 bits (91), Expect(2) = 1e-07 Identities = 24/64 (37%), Positives = 28/64 (43%) Frame = -1 Query: 297 MLLSEPNPDDGLMCEAVSKYDWYGVLVQFCRRETWFNEMLITIFHIANV*SKEYKYNKQV 118 +LLSEPNPDDGLMCEA S+EYKYNKQV Sbjct: 124 LLLSEPNPDDGLMCEA----------------------------------SREYKYNKQV 149 Query: 117 LTRR 106 ++ Sbjct: 150 FDQK 153 >gb|KVH93910.1| Ubiquitin-conjugating enzyme, active site-containing protein [Cynara cardunculus var. scolymus] Length = 488 Score = 39.7 bits (91), Expect(2) = 3e-06 Identities = 24/64 (37%), Positives = 28/64 (43%) Frame = -1 Query: 297 MLLSEPNPDDGLMCEAVSKYDWYGVLVQFCRRETWFNEMLITIFHIANV*SKEYKYNKQV 118 +LLSEPNPDDGLMCEA S+EYKYNKQV Sbjct: 140 LLLSEPNPDDGLMCEA----------------------------------SREYKYNKQV 165 Query: 117 LTRR 106 ++ Sbjct: 166 FDQK 169 Score = 38.9 bits (89), Expect(2) = 3e-06 Identities = 17/26 (65%), Positives = 22/26 (84%) Frame = -3 Query: 118 FDQKAHSMT*KYAKIDASPSHGGLQS 41 FDQKA SMT K+A+ +ASP+H GLQ+ Sbjct: 166 FDQKARSMTEKHARSEASPNHAGLQT 191