BLASTX nr result
ID: Chrysanthemum22_contig00035069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00035069 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY87675.1| hypothetical protein LSAT_6X34761 [Lactuca sativa] 62 8e-08 ref|XP_023760913.1| ubiquitin carboxyl-terminal hydrolase 8-like... 62 8e-08 ref|XP_023760912.1| ubiquitin carboxyl-terminal hydrolase 8-like... 62 8e-08 >gb|PLY87675.1| hypothetical protein LSAT_6X34761 [Lactuca sativa] Length = 864 Score = 61.6 bits (148), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 391 YGLLCRHYDTRNAGNFVAIEDNKADLFPLHVSLSISRATTSLIV 522 Y L HYD ++ GNFVA+EDNKADLFPL +SLSIS T SL+V Sbjct: 110 YRALKWHYDMKSVGNFVAVEDNKADLFPLQISLSISGTTNSLVV 153 >ref|XP_023760913.1| ubiquitin carboxyl-terminal hydrolase 8-like isoform X2 [Lactuca sativa] Length = 866 Score = 61.6 bits (148), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 391 YGLLCRHYDTRNAGNFVAIEDNKADLFPLHVSLSISRATTSLIV 522 Y L HYD ++ GNFVA+EDNKADLFPL +SLSIS T SL+V Sbjct: 112 YRALKWHYDMKSVGNFVAVEDNKADLFPLQISLSISGTTNSLVV 155 >ref|XP_023760912.1| ubiquitin carboxyl-terminal hydrolase 8-like isoform X1 [Lactuca sativa] Length = 906 Score = 61.6 bits (148), Expect = 8e-08 Identities = 29/44 (65%), Positives = 34/44 (77%) Frame = +1 Query: 391 YGLLCRHYDTRNAGNFVAIEDNKADLFPLHVSLSISRATTSLIV 522 Y L HYD ++ GNFVA+EDNKADLFPL +SLSIS T SL+V Sbjct: 152 YRALKWHYDMKSVGNFVAVEDNKADLFPLQISLSISGTTNSLVV 195