BLASTX nr result
ID: Chrysanthemum22_contig00034916
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034916 (350 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH92487.1| Cation-transporting P-type ATPase, partial [Cynar... 54 5e-06 >gb|KVH92487.1| Cation-transporting P-type ATPase, partial [Cynara cardunculus var. scolymus] Length = 780 Score = 54.3 bits (129), Expect = 5e-06 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = -3 Query: 348 NHSQEKEFPVVYVESFENLPVRGL*ATLSILELTTGI 238 NHSQEKE P VYVESFENLP RGL ATLS +E G+ Sbjct: 451 NHSQEKELPAVYVESFENLPGRGLFATLSSIEPGFGV 487