BLASTX nr result
ID: Chrysanthemum22_contig00034626
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034626 (354 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012828298.1| PREDICTED: uncharacterized protein LOC105949... 51 2e-06 gb|OMO85215.1| hypothetical protein CCACVL1_10352 [Corchorus cap... 49 9e-06 ref|XP_016457070.1| PREDICTED: uncharacterized protein LOC107780... 49 9e-06 >ref|XP_012828298.1| PREDICTED: uncharacterized protein LOC105949543 [Erythranthe guttata] Length = 36 Score = 50.8 bits (120), Expect = 2e-06 Identities = 22/36 (61%), Positives = 30/36 (83%) Frame = +3 Query: 18 IKIAMFQHLSILHCLIQTNRLAMMGGNHTAARFCTR 125 ++IA + L +L C I++NRLA++GGNHTAARFCTR Sbjct: 1 MEIARIRQLLLLWCRIRSNRLALVGGNHTAARFCTR 36 >gb|OMO85215.1| hypothetical protein CCACVL1_10352 [Corchorus capsularis] Length = 36 Score = 49.3 bits (116), Expect = 9e-06 Identities = 21/36 (58%), Positives = 29/36 (80%) Frame = +3 Query: 18 IKIAMFQHLSILHCLIQTNRLAMMGGNHTAARFCTR 125 ++I F+ L +L C I+T R+A++GGNHTAARFCTR Sbjct: 1 MEIERFRELFLLWCRIRTTRVALVGGNHTAARFCTR 36 >ref|XP_016457070.1| PREDICTED: uncharacterized protein LOC107780961 [Nicotiana tabacum] gb|PIN17690.1| hypothetical protein CDL12_09653 [Handroanthus impetiginosus] Length = 36 Score = 49.3 bits (116), Expect = 9e-06 Identities = 20/36 (55%), Positives = 30/36 (83%) Frame = +3 Query: 18 IKIAMFQHLSILHCLIQTNRLAMMGGNHTAARFCTR 125 +++A + L +L C I++NR+A++GGNHTAARFCTR Sbjct: 1 MEVARIRQLLLLWCRIRSNRVALVGGNHTAARFCTR 36