BLASTX nr result
ID: Chrysanthemum22_contig00034592
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034592 (596 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH88493.1| Leucine-rich repeat-containing protein [Cynara ca... 66 5e-09 gb|KVH88494.1| Disease resistance protein [Cynara cardunculus va... 62 8e-08 ref|XP_021981226.1| disease resistance protein RML1A-like [Helia... 62 1e-07 gb|OTG13879.1| putative toll/interleukin-1 receptor (TIR) domain... 62 1e-07 ref|XP_021981229.1| probable WRKY transcription factor 19 isofor... 62 1e-07 ref|XP_021981228.1| disease resistance protein RML1A-like isofor... 62 1e-07 ref|XP_022024322.1| uncharacterized protein LOC110924639 [Helian... 62 1e-07 gb|OTG35002.1| putative toll/interleukin-1 receptor (TIR) domain... 62 1e-07 ref|XP_021979372.1| putative disease resistance protein At4g1117... 60 3e-07 ref|XP_023752503.1| TMV resistance protein N-like isoform X3 [La... 60 7e-07 ref|XP_023752502.1| TMV resistance protein N-like isoform X2 [La... 60 7e-07 gb|PLY94043.1| hypothetical protein LSAT_7X66420 [Lactuca sativa] 60 7e-07 ref|XP_023752501.1| putative disease resistance protein At4g1117... 60 7e-07 ref|XP_022038592.1| TMV resistance protein N-like [Helianthus an... 59 9e-07 gb|KVH24344.1| hypothetical protein Ccrd_025872 [Cynara carduncu... 59 9e-07 gb|OTG25608.1| putative NB-ARC [Helianthus annuus] 59 9e-07 gb|OTG13877.1| putative concanavalin A-like lectin/glucanase dom... 59 1e-06 ref|XP_021981224.1| probable serine/threonine-protein kinase PBL... 59 1e-06 ref|XP_021979438.1| uncharacterized protein LOC110875549 [Helian... 59 2e-06 gb|OTG13951.1| putative NB-ARC [Helianthus annuus] 59 2e-06 >gb|KVH88493.1| Leucine-rich repeat-containing protein [Cynara cardunculus var. scolymus] Length = 904 Score = 65.9 bits (159), Expect = 5e-09 Identities = 34/69 (49%), Positives = 43/69 (62%) Frame = -1 Query: 209 LWSRCTWLESL*PETVV*VLCIISHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYT 30 L S W+E L + LC +++ C +F + MEVGRLT GWF ILVGD +DY Sbjct: 460 LQSEVEWVEILGGDLSGFQLCTGAYYLCRRDFFEL---MEVGRLTPGWFRILVGDTIDYA 516 Query: 29 ELRGWRKTG 3 E+RGWRKTG Sbjct: 517 EVRGWRKTG 525 >gb|KVH88494.1| Disease resistance protein [Cynara cardunculus var. scolymus] Length = 1866 Score = 62.4 bits (150), Expect = 8e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -1 Query: 140 SHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 +++ C +F+ + MEVGRLT GWF +LVGD +DYTE+RGWRKTG Sbjct: 1600 AYYLCRRDFLEL---MEVGRLTPGWFRVLVGDTIDYTEVRGWRKTG 1642 >ref|XP_021981226.1| disease resistance protein RML1A-like [Helianthus annuus] Length = 1100 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLTR WF +LVGDN+DYTE+RGWRK G Sbjct: 1030 MEVGRLTRDWFRVLVGDNIDYTEVRGWRKNG 1060 >gb|OTG13879.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1101 Score = 62.0 bits (149), Expect = 1e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLTR WF +LVGDN+DYTE+RGWRK G Sbjct: 1031 MEVGRLTRDWFRVLVGDNIDYTEVRGWRKNG 1061 >ref|XP_021981229.1| probable WRKY transcription factor 19 isoform X2 [Helianthus annuus] Length = 1351 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLTR WF ILVGD +DYTE+RGWRKTG Sbjct: 868 MEVGRLTRDWFRILVGDTIDYTEVRGWRKTG 898 >ref|XP_021981228.1| disease resistance protein RML1A-like isoform X1 [Helianthus annuus] gb|OTG13881.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1519 Score = 62.0 bits (149), Expect = 1e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLTR WF ILVGD +DYTE+RGWRKTG Sbjct: 1036 MEVGRLTRDWFRILVGDTIDYTEVRGWRKTG 1066 >ref|XP_022024322.1| uncharacterized protein LOC110924639 [Helianthus annuus] ref|XP_022024328.1| uncharacterized protein LOC110924639 [Helianthus annuus] ref|XP_022024331.1| uncharacterized protein LOC110924639 [Helianthus annuus] Length = 1206 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 140 SHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 S++ C +F + MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 671 SYYLCRHDFYSL---MEVGRLTPDWFRILVGDTIDYTEIRGWRKTG 713 >gb|OTG35002.1| putative toll/interleukin-1 receptor (TIR) domain-containing protein [Helianthus annuus] Length = 1518 Score = 61.6 bits (148), Expect = 1e-07 Identities = 28/46 (60%), Positives = 34/46 (73%) Frame = -1 Query: 140 SHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 S++ C +F + MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 983 SYYLCRHDFYSL---MEVGRLTPDWFRILVGDTIDYTEIRGWRKTG 1025 >ref|XP_021979372.1| putative disease resistance protein At4g11170 [Helianthus annuus] Length = 838 Score = 60.5 bits (145), Expect = 3e-07 Identities = 25/31 (80%), Positives = 28/31 (90%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRL+R WF ILVGD +DYTE+RGWRKTG Sbjct: 762 MEVGRLSRDWFRILVGDTIDYTEVRGWRKTG 792 >ref|XP_023752503.1| TMV resistance protein N-like isoform X3 [Lactuca sativa] Length = 1399 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = -1 Query: 191 WLESL*PETVV*VLCIISHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWR 12 W+E L + L +++ C +F + MEVGRLT WF ILVGD +DYTE+RGWR Sbjct: 1030 WVEILGGDLSGFQLSTGAYYLCRRDFFEL---MEVGRLTPDWFRILVGDTIDYTEVRGWR 1086 Query: 11 KTG 3 KTG Sbjct: 1087 KTG 1089 >ref|XP_023752502.1| TMV resistance protein N-like isoform X2 [Lactuca sativa] Length = 1424 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = -1 Query: 191 WLESL*PETVV*VLCIISHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWR 12 W+E L + L +++ C +F + MEVGRLT WF ILVGD +DYTE+RGWR Sbjct: 1030 WVEILGGDLSGFQLSTGAYYLCRRDFFEL---MEVGRLTPDWFRILVGDTIDYTEVRGWR 1086 Query: 11 KTG 3 KTG Sbjct: 1087 KTG 1089 >gb|PLY94043.1| hypothetical protein LSAT_7X66420 [Lactuca sativa] Length = 1484 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = -1 Query: 191 WLESL*PETVV*VLCIISHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWR 12 W+E L + L +++ C +F + MEVGRLT WF ILVGD +DYTE+RGWR Sbjct: 1021 WVEILGGDLSGFQLSTGAYYLCRRDFFEL---MEVGRLTPDWFRILVGDTIDYTEVRGWR 1077 Query: 11 KTG 3 KTG Sbjct: 1078 KTG 1080 >ref|XP_023752501.1| putative disease resistance protein At4g11170 isoform X1 [Lactuca sativa] Length = 1537 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/63 (49%), Positives = 40/63 (63%) Frame = -1 Query: 191 WLESL*PETVV*VLCIISHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWR 12 W+E L + L +++ C +F + MEVGRLT WF ILVGD +DYTE+RGWR Sbjct: 1030 WVEILGGDLSGFQLSTGAYYLCRRDFFEL---MEVGRLTPDWFRILVGDTIDYTEVRGWR 1086 Query: 11 KTG 3 KTG Sbjct: 1087 KTG 1089 >ref|XP_022038592.1| TMV resistance protein N-like [Helianthus annuus] Length = 1196 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 1073 MEVGRLTPDWFRILVGDTIDYTEVRGWRKTG 1103 >gb|KVH24344.1| hypothetical protein Ccrd_025872 [Cynara cardunculus var. scolymus] Length = 1196 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLTRGW +ILVG+N+D TE+RGWRKTG Sbjct: 1059 MEVGRLTRGWJSILVGNNIDDTEVRGWRKTG 1089 >gb|OTG25608.1| putative NB-ARC [Helianthus annuus] Length = 1555 Score = 59.3 bits (142), Expect = 9e-07 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 1073 MEVGRLTPDWFRILVGDTIDYTEVRGWRKTG 1103 >gb|OTG13877.1| putative concanavalin A-like lectin/glucanase domain-containing protein [Helianthus annuus] Length = 577 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 140 SHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 +++ C +F+ + MEVGRLT WF ILVGD +DYTE+RGWR+TG Sbjct: 84 AYYLCRHDFLRL---MEVGRLTPDWFRILVGDTIDYTEVRGWRQTG 126 >ref|XP_021981224.1| probable serine/threonine-protein kinase PBL18 [Helianthus annuus] Length = 633 Score = 58.9 bits (141), Expect = 1e-06 Identities = 26/46 (56%), Positives = 35/46 (76%) Frame = -1 Query: 140 SHFCCLFNFVVVIFSMEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 +++ C +F+ + MEVGRLT WF ILVGD +DYTE+RGWR+TG Sbjct: 140 AYYLCRHDFLRL---MEVGRLTPDWFRILVGDTIDYTEVRGWRQTG 182 >ref|XP_021979438.1| uncharacterized protein LOC110875549 [Helianthus annuus] Length = 803 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 505 MEVGRLTPDWFRILVGDAIDYTEVRGWRKTG 535 >gb|OTG13951.1| putative NB-ARC [Helianthus annuus] Length = 996 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 95 MEVGRLTRGWFNILVGDNVDYTELRGWRKTG 3 MEVGRLT WF ILVGD +DYTE+RGWRKTG Sbjct: 841 MEVGRLTPDWFRILVGDAIDYTEVRGWRKTG 871