BLASTX nr result
ID: Chrysanthemum22_contig00034449
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034449 (605 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ESR65245.1| hypothetical protein CICLE_v10010059mg [Citrus cl... 53 5e-06 >gb|ESR65245.1| hypothetical protein CICLE_v10010059mg [Citrus clementina] gb|KDO74246.1| hypothetical protein CISIN_1g034801mg [Citrus sinensis] Length = 83 Score = 53.1 bits (126), Expect = 5e-06 Identities = 36/84 (42%), Positives = 47/84 (55%), Gaps = 4/84 (4%) Frame = +1 Query: 178 MKLINKACLIVTVGAVIGLRHQTFRSKSYTVWQVIGTAVS---QAGLSPTALESSHKISS 348 M L NKAC++VTVGA +GLR +S S+ V + T VS QA L ++ S KI Sbjct: 1 MGLKNKACVLVTVGAALGLRDHGIKSNSFAVKPELTTIVSSILQAKLD--QVDRSKKILE 58 Query: 349 NAKK-PKDIKEPLRSVAYLSLWGP 417 + + +E LR V YLS WGP Sbjct: 59 KGNEMHQAAEESLRMVVYLSCWGP 82