BLASTX nr result
ID: Chrysanthemum22_contig00034319
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034319 (368 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022010244.1| U3 small nucleolar ribonucleoprotein protein... 56 1e-06 >ref|XP_022010244.1| U3 small nucleolar ribonucleoprotein protein MPP10 [Helianthus annuus] gb|OTF93593.1| putative U3 small nucleolar ribonucleoprotein complex, subunit Mpp10 [Helianthus annuus] Length = 551 Score = 56.2 bits (134), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 368 RRASKKRKFKAEYANKIAKKPRESAKTADDGKEE 267 RRASKKRKFKAE A K+AKKPRE+ +TA DGKEE Sbjct: 518 RRASKKRKFKAENAKKMAKKPRENTQTAGDGKEE 551