BLASTX nr result
ID: Chrysanthemum22_contig00034033
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00034033 (522 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|WP_088334776.1| 30S ribosomal protein S15 [Methanopyrus sp. ... 59 1e-07 sp|Q8TV08.1|RS15_METKA RecName: Full=30S ribosomal protein S15 >... 59 1e-07 ref|WP_054845206.1| 30S ribosomal protein S15 [Sulfolobus sp. JC... 57 7e-07 ref|WP_069591992.1| 30S ribosomal protein S15 [Methanosphaera sp... 56 9e-07 ref|WP_012022172.1| 30S ribosomal protein S15 [Metallosphaera se... 56 9e-07 ref|WP_011405629.1| MULTISPECIES: 30S ribosomal protein S15 [Met... 55 1e-06 gb|KXB00536.1| 30S ribosomal protein S15 [candidate divison MSBL... 55 2e-06 gb|OYT51506.1| 30S ribosomal protein S15 [Desulfurococcales arch... 55 2e-06 ref|WP_048100158.1| 30S ribosomal protein S15 [Candidatus Acidia... 55 2e-06 ref|WP_023993136.1| 30S ribosomal protein S15 [Methanobacterium ... 55 2e-06 ref|WP_095608167.1| 30S ribosomal protein S15 [Methanosphaera cu... 55 2e-06 ref|WP_014788019.1| 30S ribosomal protein S15 [Thermococcus clef... 55 3e-06 ref|WP_068666677.1| 30S ribosomal protein S15 [Thermococcus piez... 55 3e-06 ref|XP_002176615.1| predicted protein [Phaeodactylum tricornutum... 55 3e-06 gb|AFR90232.1| ribosomal protein S13 [Sterkiella nova] 55 3e-06 ref|WP_013826917.1| 30S ribosomal protein S15 [Methanobacterium ... 54 3e-06 dbj|GAX16259.1| small subunit ribosomal protein S13e [Fistulifer... 54 4e-06 ref|WP_014026440.1| 30S ribosomal protein S15 [Pyrolobus fumarii... 54 5e-06 gb|ODV89943.1| hypothetical protein CANCADRAFT_31047 [Tortispora... 54 6e-06 ref|WP_055428677.1| 30S ribosomal protein S15 [Thermococcus thio... 54 6e-06 >ref|WP_088334776.1| 30S ribosomal protein S15 [Methanopyrus sp. KOL6] Length = 149 Score = 58.5 bits (140), Expect = 1e-07 Identities = 33/84 (39%), Positives = 49/84 (58%) Frame = -2 Query: 356 VILLPPQKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQI 177 V L+ +K E+ E+P DL +LI+ A + RE LKR+P + +KR L+ E +I Sbjct: 63 VKLITGKKVTEILEEHGLAPELPEDLLNLIRRAKRVREHLKRHPKDLHSKRGLQLIESKI 122 Query: 176 HRRYLFYRFKTEELPSGWRYDPKA 105 HR +Y+ K LP W+YDP+A Sbjct: 123 HRLVKYYKRK-GILPEDWKYDPEA 145 >sp|Q8TV08.1|RS15_METKA RecName: Full=30S ribosomal protein S15 gb|AAM02806.1| Ribosomal protein S15P/S13E [Methanopyrus kandleri AV19] Length = 149 Score = 58.5 bits (140), Expect = 1e-07 Identities = 33/84 (39%), Positives = 49/84 (58%) Frame = -2 Query: 356 VILLPPQKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQI 177 V L+ +K E+ E+P DL +LI+ A + RE LKR+P + +KR L+ E +I Sbjct: 63 VKLITGKKITEILEEHGLAPELPEDLLNLIRRAKRVREHLKRHPKDLHSKRGLQLIESKI 122 Query: 176 HRRYLFYRFKTEELPSGWRYDPKA 105 HR +Y+ K LP W+YDP+A Sbjct: 123 HRLVKYYKRK-GVLPEDWKYDPEA 145 >ref|WP_054845206.1| 30S ribosomal protein S15 [Sulfolobus sp. JCM 16833] Length = 154 Score = 56.6 bits (135), Expect = 7e-07 Identities = 31/68 (45%), Positives = 42/68 (61%), Gaps = 1/68 (1%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 +IP DL++LI+ A R L P ++ AKR LE+ E +I RR Y + E+LP WRY Sbjct: 81 KIPEDLFNLIKKAVNVRRHLSEYPKDKKAKRGLEEVESKI-RRLSRYYVEVEKLPRDWRY 139 Query: 116 DP-KASLM 96 DP KA L+ Sbjct: 140 DPAKAELL 147 >ref|WP_069591992.1| 30S ribosomal protein S15 [Methanosphaera sp. WGK6] gb|OED30809.1| 30S ribosomal protein S15 [Methanosphaera sp. WGK6] Length = 133 Score = 55.8 bits (133), Expect = 9e-07 Identities = 35/93 (37%), Positives = 49/93 (52%) Frame = -2 Query: 374 PSTSRLVILLPPQKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLE 195 PST +V +K ++ + T E P DL +LI+ A RE L+ NP + +KR L Sbjct: 43 PSTKTVV----GEKITDILKRNGTDFEYPEDLLNLIKRAVNIREHLEENPKDIHSKRGLI 98 Query: 194 DYEYQIHRRYLFYRFKTEELPSGWRYDPKASLM 96 E +I RR + Y LP GWRYDPK + + Sbjct: 99 KIESKI-RRLVRYYTANNVLPEGWRYDPKTAAL 130 >ref|WP_012022172.1| 30S ribosomal protein S15 [Metallosphaera sedula] sp|A4YIY3.1|RS15_METS5 RecName: Full=30S ribosomal protein S15 gb|ABP96385.1| SSU ribosomal protein S15P [Metallosphaera sedula DSM 5348] gb|AIM28368.1| SSU ribosomal protein S15P [Metallosphaera sedula] gb|AKV75162.1| 30S ribosomal protein S15 [Metallosphaera sedula] gb|AKV77398.1| 30S ribosomal protein S15 [Metallosphaera sedula] gb|AKV79650.1| 30S ribosomal protein S15 [Metallosphaera sedula] gb|AKV81895.1| 30S ribosomal protein S15 [Metallosphaera sedula] gb|AKV84130.1| 30S ribosomal protein S15 [Metallosphaera sedula] Length = 152 Score = 56.2 bits (134), Expect = 9e-07 Identities = 28/69 (40%), Positives = 44/69 (63%), Gaps = 1/69 (1%) Frame = -2 Query: 299 TEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWR 120 ++IP DL++LI+ A R L P +++AK+ LE+ E +I R +Y+ + E+LP W Sbjct: 80 SQIPEDLFNLIRRAVNVRRHLNEYPGDKTAKKGLEEIESKIRRLSRYYK-RVEKLPQDWT 138 Query: 119 YDP-KASLM 96 YDP KA L+ Sbjct: 139 YDPAKAELL 147 >ref|WP_011405629.1| MULTISPECIES: 30S ribosomal protein S15 [Methanosphaera] sp|Q2NIA9.1|RS15_METST RecName: Full=30S ribosomal protein S15 gb|ABC56430.1| 30S ribosomal protein S15P [Methanosphaera stadtmanae DSM 3091] gb|OEC87140.1| 30S ribosomal protein S15 [Methanosphaera sp. A6] Length = 133 Score = 55.5 bits (132), Expect = 1e-06 Identities = 31/81 (38%), Positives = 44/81 (54%) Frame = -2 Query: 338 QKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLF 159 +K ++ + T E P DL +LI+ A RE L+ NP + KR L E +I RR + Sbjct: 51 EKITDILKRNGTDFEYPEDLLNLIKRAVNIREHLEENPKDIHTKRGLIKIESKI-RRLVK 109 Query: 158 YRFKTEELPSGWRYDPKASLM 96 Y + LP GWRYDPK + + Sbjct: 110 YYTRNNVLPEGWRYDPKTAAL 130 >gb|KXB00536.1| 30S ribosomal protein S15 [candidate divison MSBL1 archaeon SCGC-AAA261C02] gb|KXB03486.1| 30S ribosomal protein S15 [candidate divison MSBL1 archaeon SCGC-AAA261G05] Length = 134 Score = 55.1 bits (131), Expect = 2e-06 Identities = 28/74 (37%), Positives = 41/74 (55%) Frame = -2 Query: 323 VSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKT 144 + +I +P E+P DL L+ A + L+RNP + KR LE+ E +IH +Y+ K Sbjct: 57 LKSIGESP-EVPEDLMSLLSKAVDLHDHLERNPRDSRTKRSLEELESRIHELTKYYK-KK 114 Query: 143 EELPSGWRYDPKAS 102 LP WRY P A+ Sbjct: 115 GRLPEAWRYSPAAA 128 >gb|OYT51506.1| 30S ribosomal protein S15 [Desulfurococcales archaeon ex4484_217_2] Length = 152 Score = 55.5 bits (132), Expect = 2e-06 Identities = 26/63 (41%), Positives = 43/63 (68%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 EIP DL++L++ AA+ R L+ +P + +KR LE+ E +I RR + Y + +LP GW+Y Sbjct: 81 EIPEDLFNLMKRAARLRAHLEEHPKDYHSKRGLEEIESKI-RRLVKYYVRVGKLPKGWKY 139 Query: 116 DPK 108 +P+ Sbjct: 140 EPE 142 >ref|WP_048100158.1| 30S ribosomal protein S15 [Candidatus Acidianus copahuensis] gb|EZQ03108.1| 30S ribosomal protein S15 [Candidatus Acidianus copahuensis] Length = 152 Score = 55.5 bits (132), Expect = 2e-06 Identities = 27/65 (41%), Positives = 41/65 (63%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 +IP DL++LI+ A R L P ++ +K+ LE+ E +I R +YR T +LP+ WRY Sbjct: 81 QIPEDLFNLIRKAVNVRRHLVEYPKDKVSKKGLEEIESKIRRLVNYYRV-TGKLPANWRY 139 Query: 116 DPKAS 102 DP A+ Sbjct: 140 DPAAA 144 >ref|WP_023993136.1| 30S ribosomal protein S15 [Methanobacterium sp. MB1] emb|CDG66113.1| 30S ribosomal protein S15/S13e [Methanobacterium sp. MB1] Length = 133 Score = 54.7 bits (130), Expect = 2e-06 Identities = 32/68 (47%), Positives = 41/68 (60%), Gaps = 1/68 (1%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 E P DL +LI+ A RE LK NP + KR L+ E +I RR + Y + LP GWRY Sbjct: 65 EYPEDLMNLIRKAVNIREHLKENPKDLHTKRGLQLVESKI-RRLVKYYTREGVLPEGWRY 123 Query: 116 DP-KASLM 96 DP KA+L+ Sbjct: 124 DPQKAALL 131 >ref|WP_095608167.1| 30S ribosomal protein S15 [Methanosphaera cuniculi] gb|PAV07962.1| 30S ribosomal protein S15 [Methanosphaera cuniculi] Length = 134 Score = 54.7 bits (130), Expect = 2e-06 Identities = 32/81 (39%), Positives = 44/81 (54%) Frame = -2 Query: 338 QKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLF 159 QK E+ + E P DL +LI+ A RE L+ NP + +KR L E +I RR + Sbjct: 52 QKITEILEKNGEVFEYPEDLLNLIKRAINIREHLEENPKDIHSKRGLIKIESKI-RRLVK 110 Query: 158 YRFKTEELPSGWRYDPKASLM 96 Y + LP GWRYDPK + + Sbjct: 111 YYTRNNVLPEGWRYDPKEAAL 131 >ref|WP_014788019.1| 30S ribosomal protein S15 [Thermococcus cleftensis] gb|AFL94378.1| 30S ribosomal protein S15 [Thermococcus cleftensis] Length = 151 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/63 (42%), Positives = 43/63 (68%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 EIP DL LI+ A K R+ L+++P ++ ++R L+ E +I R +YR +T +LP+ WRY Sbjct: 83 EIPEDLMALIRKAVKLRKHLEQHPKDKHSRRGLQLTESKIRRLVKYYR-RTGKLPAKWRY 141 Query: 116 DPK 108 DP+ Sbjct: 142 DPE 144 >ref|WP_068666677.1| 30S ribosomal protein S15 [Thermococcus piezophilus] gb|ANF23228.1| 30S ribosomal protein S15 [Thermococcus piezophilus] Length = 151 Score = 54.7 bits (130), Expect = 3e-06 Identities = 27/63 (42%), Positives = 43/63 (68%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 EIP DL LI+ A K R+ L+++P ++ ++R L+ E +I R +YR +T +LP+ WRY Sbjct: 83 EIPEDLMALIRKAVKLRKHLEQHPKDKHSRRGLQLTESKIRRLVKYYR-RTGKLPAKWRY 141 Query: 116 DPK 108 DP+ Sbjct: 142 DPE 144 >ref|XP_002176615.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] gb|EEC51078.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1] Length = 151 Score = 54.7 bits (130), Expect = 3e-06 Identities = 29/75 (38%), Positives = 45/75 (60%) Frame = -2 Query: 338 QKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLF 159 QK + + + EIP DLY LI+ A + R+ L+RN ++ +K +L E +IHR + Sbjct: 69 QKVVRILKANGLAPEIPEDLYMLIKKAVQVRKHLERNRKDKDSKFRLILIESRIHRLARY 128 Query: 158 YRFKTEELPSGWRYD 114 YR T +LPS W+Y+ Sbjct: 129 YR-TTRKLPSNWKYE 142 >gb|AFR90232.1| ribosomal protein S13 [Sterkiella nova] Length = 151 Score = 54.7 bits (130), Expect = 3e-06 Identities = 28/63 (44%), Positives = 40/63 (63%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 +IP DLY LI+ A R+ L+RN +R K +L E +IHR +YR +T++LP WRY Sbjct: 83 QIPEDLYHLIKKAVNVRKHLERNRKDRDGKFRLILTESRIHRLARYYR-RTKQLPPTWRY 141 Query: 116 DPK 108 + K Sbjct: 142 ESK 144 >ref|WP_013826917.1| 30S ribosomal protein S15 [Methanobacterium paludis] gb|AEG19418.1| ribosomal protein S15 [Methanobacterium paludis] Length = 133 Score = 54.3 bits (129), Expect = 3e-06 Identities = 30/67 (44%), Positives = 36/67 (53%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 E P DL +LI+ A RE L NP + KR L E I RR + Y K LP GWRY Sbjct: 65 EYPEDLMNLIRKAVNVREHLDENPKDLHTKRGLRIVESNI-RRLVRYYTKEGVLPEGWRY 123 Query: 116 DPKASLM 96 DPK + + Sbjct: 124 DPKTAAL 130 >dbj|GAX16259.1| small subunit ribosomal protein S13e [Fistulifera solaris] dbj|GAX15813.1| small subunit ribosomal protein S13e [Fistulifera solaris] Length = 151 Score = 54.3 bits (129), Expect = 4e-06 Identities = 29/75 (38%), Positives = 45/75 (60%) Frame = -2 Query: 338 QKELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLF 159 QK + + + EIP DLY LI+ A + R+ L+RN ++ +K +L E +IHR + Sbjct: 69 QKIVRILKANGLAPEIPEDLYMLIKKAVQVRKHLERNRKDKDSKFRLILIESRIHRLARY 128 Query: 158 YRFKTEELPSGWRYD 114 YR T +LPS W+Y+ Sbjct: 129 YR-TTRKLPSNWKYE 142 >ref|WP_014026440.1| 30S ribosomal protein S15 [Pyrolobus fumarii] gb|AEM38763.1| Ribosomal S13S15 domain protein [Pyrolobus fumarii 1A] Length = 163 Score = 54.3 bits (129), Expect = 5e-06 Identities = 25/62 (40%), Positives = 38/62 (61%) Frame = -2 Query: 293 IPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRYD 114 +P DL+ L+Q A R L+ +P + AK+ L D E +IHR +Y+ + +LP WRYD Sbjct: 82 VPEDLFRLLQKAVNLRRHLEEHPKDTHAKKGLMDLESKIHRLVKYYK-RVGKLPPDWRYD 140 Query: 113 PK 108 P+ Sbjct: 141 PE 142 >gb|ODV89943.1| hypothetical protein CANCADRAFT_31047 [Tortispora caseinolytica NRRL Y-17796] Length = 145 Score = 53.9 bits (128), Expect = 6e-06 Identities = 30/74 (40%), Positives = 42/74 (56%) Frame = -2 Query: 335 KELEVSTISTTPTEIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFY 156 K L + S +IP DLY LI+ A R+ L+RN +R AK +L E +IHR +Y Sbjct: 64 KILRILKTSGLAPDIPEDLYQLIKKALNVRKHLERNRKDRDAKFRLILIESRIHRLARYY 123 Query: 155 RFKTEELPSGWRYD 114 R T LP+ W+Y+ Sbjct: 124 R-STAVLPANWKYE 136 >ref|WP_055428677.1| 30S ribosomal protein S15 [Thermococcus thioreducens] gb|KQH83022.1| 30S ribosomal protein S15 [Thermococcus thioreducens] emb|SEV93491.1| SSU ribosomal protein S15P [Thermococcus thioreducens] gb|ASJ12287.1| 30S ribosomal protein S15 [Thermococcus thioreducens] Length = 151 Score = 53.9 bits (128), Expect = 6e-06 Identities = 27/63 (42%), Positives = 42/63 (66%) Frame = -2 Query: 296 EIPNDLYDLIQNAAKARESLKRNPDNRSAKRKLEDYEYQIHRRYLFYRFKTEELPSGWRY 117 EIP DL LI+ A K R+ L+ +P ++ ++R L+ E +I R +YR +T +LP+ WRY Sbjct: 83 EIPEDLMALIRKAVKLRKHLEMHPKDKHSRRGLQLTESKIRRLVKYYR-RTGKLPAKWRY 141 Query: 116 DPK 108 DP+ Sbjct: 142 DPE 144