BLASTX nr result
ID: Chrysanthemum22_contig00033985
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033985 (384 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023754135.1| pentatricopeptide repeat-containing protein ... 65 1e-09 ref|XP_021972839.1| pentatricopeptide repeat-containing protein ... 64 3e-09 gb|OTG20348.1| putative tetratricopeptide repeat (TPR)-like supe... 64 3e-09 gb|KVI08748.1| Pentatricopeptide repeat-containing protein [Cyna... 60 6e-08 >ref|XP_023754135.1| pentatricopeptide repeat-containing protein At2g17670 [Lactuca sativa] gb|PLY92793.1| hypothetical protein LSAT_2X74520 [Lactuca sativa] Length = 480 Score = 65.1 bits (157), Expect = 1e-09 Identities = 28/41 (68%), Positives = 36/41 (87%) Frame = -2 Query: 125 HPSILNNRFCNSVLQSFTNVSNTLQDSIVLLNHMQKTHPLF 3 + S+LNNRFCN+VLQSF++VS+ +QDSI+LLNHM K HP F Sbjct: 94 YSSLLNNRFCNAVLQSFSSVSSNIQDSIILLNHMTKIHPSF 134 >ref|XP_021972839.1| pentatricopeptide repeat-containing protein At2g17670 [Helianthus annuus] Length = 470 Score = 63.9 bits (154), Expect = 3e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 125 HPSILNNRFCNSVLQSFTNVSNTLQDSIVLLNHMQKTHPLF 3 HPS+L NRFCN +L+SFT+VS+ +QDSI LL HM K +PLF Sbjct: 84 HPSLLTNRFCNKILESFTSVSSNIQDSIFLLTHMTKVNPLF 124 >gb|OTG20348.1| putative tetratricopeptide repeat (TPR)-like superfamily protein [Helianthus annuus] Length = 488 Score = 63.9 bits (154), Expect = 3e-09 Identities = 27/41 (65%), Positives = 34/41 (82%) Frame = -2 Query: 125 HPSILNNRFCNSVLQSFTNVSNTLQDSIVLLNHMQKTHPLF 3 HPS+L NRFCN +L+SFT+VS+ +QDSI LL HM K +PLF Sbjct: 84 HPSLLTNRFCNKILESFTSVSSNIQDSIFLLTHMTKVNPLF 124 >gb|KVI08748.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 482 Score = 60.1 bits (144), Expect = 6e-08 Identities = 25/38 (65%), Positives = 34/38 (89%) Frame = -2 Query: 116 ILNNRFCNSVLQSFTNVSNTLQDSIVLLNHMQKTHPLF 3 ++NNR CN++LQSF++VS+ +QDSIVLLNHM KT+P F Sbjct: 99 LINNRLCNAILQSFSSVSSNIQDSIVLLNHMTKTYPSF 136