BLASTX nr result
ID: Chrysanthemum22_contig00033978
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033978 (360 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVI11943.1| Transcription factor IIA, alpha/beta subunit [Cyn... 82 7e-16 gb|KVI03641.1| Transcription factor IIA, alpha/beta subunit [Cyn... 76 7e-14 ref|XP_023758816.1| transcription initiation factor IIA large su... 72 2e-12 gb|PLY89218.1| hypothetical protein LSAT_5X169601 [Lactuca sativa] 72 2e-12 ref|XP_021973092.1| transcription initiation factor IIA large su... 72 3e-12 ref|XP_021972887.1| uncharacterized protein LOC110868101 isoform... 68 6e-11 ref|XP_021972880.1| transcription initiation factor IIA large su... 68 7e-11 ref|XP_022853232.1| transcription initiation factor IIA large su... 66 3e-10 emb|CDP09102.1| unnamed protein product [Coffea canephora] 66 3e-10 ref|XP_022853231.1| transcription initiation factor IIA large su... 66 3e-10 ref|XP_022853230.1| transcription initiation factor IIA large su... 66 3e-10 gb|PLY74855.1| hypothetical protein LSAT_8X72760 [Lactuca sativa] 61 4e-09 ref|XP_016577754.1| PREDICTED: transcription initiation factor I... 62 7e-09 ref|XP_016577757.1| PREDICTED: transcription initiation factor I... 62 1e-08 gb|PHT46736.1| Transcription initiation factor IIA subunit 1 [Ca... 62 1e-08 ref|XP_016577755.1| PREDICTED: transcription initiation factor I... 62 1e-08 ref|XP_016577753.1| PREDICTED: transcription initiation factor I... 62 1e-08 ref|XP_004241212.1| PREDICTED: transcription initiation factor I... 61 3e-08 ref|XP_006350788.1| PREDICTED: transcription initiation factor I... 61 3e-08 ref|XP_020550528.1| transcription initiation factor IIA large su... 61 3e-08 >gb|KVI11943.1| Transcription factor IIA, alpha/beta subunit [Cynara cardunculus var. scolymus] Length = 513 Score = 82.4 bits (202), Expect = 7e-16 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGTVD+SYNI T GTPITPNDYP +G S + +GRPSP+M Sbjct: 195 TPLPGTAPTPLPGTVDSSYNIPTGGTPITPNDYPPVNEDGASESRAGRPSPYM 247 >gb|KVI03641.1| Transcription factor IIA, alpha/beta subunit [Cynara cardunculus var. scolymus] Length = 357 Score = 76.3 bits (186), Expect = 7e-14 Identities = 36/53 (67%), Positives = 39/53 (73%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGTVD SYNI T GTPITP+DY NG S +GRPS +M Sbjct: 114 TPLPGTAPTPLPGTVDNSYNIPTGGTPITPSDYSSLNENGASDGKAGRPSTYM 166 >ref|XP_023758816.1| transcription initiation factor IIA large subunit [Lactuca sativa] Length = 384 Score = 72.4 bits (176), Expect = 2e-12 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGT+D +YNI T GTPITP+DYP NG S SGRP+ +M Sbjct: 114 TPLPGTAPTPLPGTMD-NYNIPTGGTPITPSDYPSINENGVSDGKSGRPNTYM 165 >gb|PLY89218.1| hypothetical protein LSAT_5X169601 [Lactuca sativa] Length = 427 Score = 72.4 bits (176), Expect = 2e-12 Identities = 35/53 (66%), Positives = 40/53 (75%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGT+D +YNI T GTPITP+DYP NG S SGRP+ +M Sbjct: 114 TPLPGTAPTPLPGTMD-NYNIPTGGTPITPSDYPSINENGVSDGKSGRPNTYM 165 >ref|XP_021973092.1| transcription initiation factor IIA large subunit-like [Helianthus annuus] gb|OTG36718.1| putative transcription factor IIA, alpha/beta subunit, Transcription factor IIA, helical [Helianthus annuus] Length = 387 Score = 72.0 bits (175), Expect = 3e-12 Identities = 36/56 (64%), Positives = 39/56 (69%), Gaps = 3/56 (5%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSG---RPSPHM 160 TPLPGTA TPLPGT++ SYNI T GTPITP+DY NG SG PS PSP M Sbjct: 114 TPLPGTAPTPLPGTMENSYNIPTGGTPITPSDYSSINENGASGRPSAYMQAPSPWM 169 >ref|XP_021972887.1| uncharacterized protein LOC110868101 isoform X2 [Helianthus annuus] Length = 344 Score = 68.2 bits (165), Expect = 6e-11 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGT++ SYNI T GTPITP+DY NG S + GRPS +M Sbjct: 68 TPLPGTAPTPLPGTMENSYNIPTGGTPITPSDYSSINENGAS-DRVGRPSAYM 119 >ref|XP_021972880.1| transcription initiation factor IIA large subunit-like isoform X1 [Helianthus annuus] gb|OTG36695.1| putative transcription factor IIA, alpha/beta subunit [Helianthus annuus] Length = 390 Score = 68.2 bits (165), Expect = 7e-11 Identities = 34/53 (64%), Positives = 39/53 (73%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSPHM 160 TPLPGTA TPLPGT++ SYNI T GTPITP+DY NG S + GRPS +M Sbjct: 114 TPLPGTAPTPLPGTMENSYNIPTGGTPITPSDYSSINENGAS-DRVGRPSAYM 165 >ref|XP_022853232.1| transcription initiation factor IIA large subunit-like isoform X3 [Olea europaea var. sylvestris] Length = 407 Score = 66.2 bits (160), Expect = 3e-10 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNP-----SGRPSPHM 160 TPLPGTA TPLPGT D + YNI T GTPITPN+Y A NG G P +GRPSP+M Sbjct: 113 TPLPGTAQTPLPGTADNNSYYNIHTGGTPITPNEYSSANDNG--GVPEMRGGAGRPSPYM 170 >emb|CDP09102.1| unnamed protein product [Coffea canephora] Length = 411 Score = 66.2 bits (160), Expect = 3e-10 Identities = 36/59 (61%), Positives = 40/59 (67%), Gaps = 6/59 (10%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS-YNITTVGTPITPNDYPRAVGNGTSGNPS-----GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTPITPN+Y N + G P GRPSP+M Sbjct: 121 TPLPGTAQTPLPGTADSSLYNIPTGGTPITPNEYSSV--NDSGGAPEVKPGPGRPSPYM 177 >ref|XP_022853231.1| transcription initiation factor IIA large subunit-like isoform X2 [Olea europaea var. sylvestris] Length = 444 Score = 66.2 bits (160), Expect = 3e-10 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNP-----SGRPSPHM 160 TPLPGTA TPLPGT D + YNI T GTPITPN+Y A NG G P +GRPSP+M Sbjct: 150 TPLPGTAQTPLPGTADNNSYYNIHTGGTPITPNEYSSANDNG--GVPEMRGGAGRPSPYM 207 >ref|XP_022853230.1| transcription initiation factor IIA large subunit-like isoform X1 [Olea europaea var. sylvestris] Length = 448 Score = 66.2 bits (160), Expect = 3e-10 Identities = 37/60 (61%), Positives = 41/60 (68%), Gaps = 7/60 (11%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNP-----SGRPSPHM 160 TPLPGTA TPLPGT D + YNI T GTPITPN+Y A NG G P +GRPSP+M Sbjct: 154 TPLPGTAQTPLPGTADNNSYYNIHTGGTPITPNEYSSANDNG--GVPEMRGGAGRPSPYM 211 >gb|PLY74855.1| hypothetical protein LSAT_8X72760 [Lactuca sativa] Length = 168 Score = 61.2 bits (147), Expect = 4e-09 Identities = 27/51 (52%), Positives = 33/51 (64%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTSYNITTVGTPITPNDYPRAVGNGTSGNPSGRPSP 154 T LP T T LP ++D SYN+ +GTP+TPNDYP G S + GRPSP Sbjct: 118 TTLPATTLTHLPSSMDNSYNLPAMGTPMTPNDYPHVNNKGASESRVGRPSP 168 >ref|XP_016577754.1| PREDICTED: transcription initiation factor IIA large subunit isoform X2 [Capsicum annuum] Length = 401 Score = 62.4 bits (150), Expect = 7e-09 Identities = 34/63 (53%), Positives = 38/63 (60%), Gaps = 5/63 (7%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNPS---GRPSPHMVI 166 TPLPGTA TPLPGT D+S YNI T GTP TP+DY G + GRPSP M Sbjct: 120 TPLPGTAQTPLPGTADSSSLYNIPTGGTPFTPSDYSPLNDTGVAAEVKTGPGRPSPFMPP 179 Query: 167 LPY 175 P+ Sbjct: 180 SPW 182 >ref|XP_016577757.1| PREDICTED: transcription initiation factor IIA large subunit isoform X4 [Capsicum annuum] Length = 361 Score = 61.6 bits (148), Expect = 1e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNPS---GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY G + GRPSP M Sbjct: 120 TPLPGTAQTPLPGTADSSSLYNIPTGGTPFTPSDYSPLNDTGVAAEVKTGPGRPSPFM 177 >gb|PHT46736.1| Transcription initiation factor IIA subunit 1 [Capsicum baccatum] gb|PHU16120.1| Transcription initiation factor IIA subunit 1 [Capsicum chinense] Length = 400 Score = 61.6 bits (148), Expect = 1e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNPS---GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY G + GRPSP M Sbjct: 120 TPLPGTAQTPLPGTADSSSLYNIPTGGTPFTPSDYSPLNDTGVAAEVKTGPGRPSPFM 177 >ref|XP_016577755.1| PREDICTED: transcription initiation factor IIA large subunit isoform X3 [Capsicum annuum] gb|PHT80227.1| hypothetical protein T459_18279 [Capsicum annuum] Length = 400 Score = 61.6 bits (148), Expect = 1e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNPS---GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY G + GRPSP M Sbjct: 120 TPLPGTAQTPLPGTADSSSLYNIPTGGTPFTPSDYSPLNDTGVAAEVKTGPGRPSPFM 177 >ref|XP_016577753.1| PREDICTED: transcription initiation factor IIA large subunit isoform X1 [Capsicum annuum] Length = 402 Score = 61.6 bits (148), Expect = 1e-08 Identities = 33/58 (56%), Positives = 36/58 (62%), Gaps = 5/58 (8%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS--YNITTVGTPITPNDYPRAVGNGTSGNPS---GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY G + GRPSP M Sbjct: 120 TPLPGTAQTPLPGTADSSSLYNIPTGGTPFTPSDYSPLNDTGVAAEVKTGPGRPSPFM 177 >ref|XP_004241212.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum lycopersicum] ref|XP_015079667.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum pennellii] Length = 401 Score = 60.8 bits (146), Expect = 3e-08 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS-YNITTVGTPITPNDYPRAVGNGTSGNPS-----GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY N T G GRPSP M Sbjct: 119 TPLPGTAQTPLPGTADSSMYNIPTGGTPFTPSDYSPL--NDTGGATELKAGPGRPSPFM 175 >ref|XP_006350788.1| PREDICTED: transcription initiation factor IIA large subunit [Solanum tuberosum] Length = 403 Score = 60.8 bits (146), Expect = 3e-08 Identities = 35/59 (59%), Positives = 37/59 (62%), Gaps = 6/59 (10%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS-YNITTVGTPITPNDYPRAVGNGTSGNPS-----GRPSPHM 160 TPLPGTA TPLPGT D+S YNI T GTP TP+DY N T G GRPSP M Sbjct: 119 TPLPGTAQTPLPGTADSSMYNIPTGGTPFTPSDYSPL--NDTGGATELKAGPGRPSPFM 175 >ref|XP_020550528.1| transcription initiation factor IIA large subunit [Sesamum indicum] Length = 409 Score = 60.8 bits (146), Expect = 3e-08 Identities = 34/57 (59%), Positives = 38/57 (66%), Gaps = 4/57 (7%) Frame = +2 Query: 2 TPLPGTASTPLPGTVDTS-YNITTVGTPITPNDYPRAVGNG---TSGNPSGRPSPHM 160 TPLPGTA TPLPG+ +S YNI T GTPITPN+Y NG P GRPSP+M Sbjct: 125 TPLPGTAPTPLPGSDSSSLYNIPTGGTPITPNEYTSTNENGVPEVKAGP-GRPSPYM 180