BLASTX nr result
ID: Chrysanthemum22_contig00033663
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033663 (440 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KVH93492.1| Ankyrin repeat-containing protein [Cynara cardunc... 63 1e-08 ref|XP_022015503.1| potassium channel AKT2/3-like [Helianthus an... 61 7e-08 ref|XP_021988746.1| potassium channel AKT2/3 [Helianthus annuus]... 60 9e-08 ref|XP_023730253.1| potassium channel AKT2/3 [Lactuca sativa] >g... 57 2e-06 >gb|KVH93492.1| Ankyrin repeat-containing protein [Cynara cardunculus var. scolymus] Length = 832 Score = 62.8 bits (151), Expect = 1e-08 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -2 Query: 289 LIVGWREEGVDGDPNMSTNLLTVSGRVNAAFLDELIKARLD 167 L++ EEGVDGDPNMS NLLTV+G NAAFLDEL+KARLD Sbjct: 536 LLLEGGEEGVDGDPNMSMNLLTVAGTGNAAFLDELLKARLD 576 >ref|XP_022015503.1| potassium channel AKT2/3-like [Helianthus annuus] gb|OTF91709.1| putative potassium channel, voltage-dependent, EAG/ELK/ERG, Ankyrin repeat-containing domain protein [Helianthus annuus] Length = 849 Score = 60.8 bits (146), Expect = 7e-08 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -2 Query: 289 LIVGWREEGVDGDPNMSTNLLTVSGRVNAAFLDELIKARLD 167 L++ EE VDGDPNMS NLLTV+G NAAFLDEL+KARLD Sbjct: 538 LLLDGGEESVDGDPNMSMNLLTVAGTGNAAFLDELLKARLD 578 >ref|XP_021988746.1| potassium channel AKT2/3 [Helianthus annuus] ref|XP_021988747.1| potassium channel AKT2/3 [Helianthus annuus] gb|OTG11388.1| putative potassium transport 2/3 [Helianthus annuus] Length = 841 Score = 60.5 bits (145), Expect = 9e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = -2 Query: 289 LIVGWREEGVDGDPNMSTNLLTVSGRVNAAFLDELIKARLD 167 L++ EE +DGDPNMS NLLTV+G NAAFLDEL+KARLD Sbjct: 533 LLLDGGEESIDGDPNMSMNLLTVAGTGNAAFLDELLKARLD 573 >ref|XP_023730253.1| potassium channel AKT2/3 [Lactuca sativa] gb|PLY76624.1| hypothetical protein LSAT_5X105600 [Lactuca sativa] Length = 846 Score = 56.6 bits (135), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -2 Query: 271 EEGVDGDPNMSTNLLTVSGRVNAAFLDELIKARLD 167 EE DGDPNMS NLLT++G NAAFLDEL+KARLD Sbjct: 544 EEDGDGDPNMSMNLLTIAGTGNAAFLDELLKARLD 578