BLASTX nr result
ID: Chrysanthemum22_contig00033577
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033577 (569 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] 97 8e-23 >gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] Length = 86 Score = 96.7 bits (239), Expect = 8e-23 Identities = 53/86 (61%), Positives = 59/86 (68%), Gaps = 2/86 (2%) Frame = -2 Query: 493 MSCKPVPXXXXXXXXXXXXXXFGYEKHTFPRARFPLRRMM--ARSHLTSLSTDPSMHKGA 320 M+CKP+ FGYE+HTFP RF RR++ A S LTSLSTDPS KGA Sbjct: 1 MTCKPLFFLFFLIFFHLLVMSFGYERHTFPTERFQPRRLLKTAASSLTSLSTDPSKLKGA 60 Query: 319 AMNELQTSVQDSLRKRPPSKSNPSHN 242 AMNE QTSV+DSLRKRPPS SNPSHN Sbjct: 61 AMNEPQTSVEDSLRKRPPSASNPSHN 86