BLASTX nr result
ID: Chrysanthemum22_contig00033576
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033576 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] 66 2e-11 >gb|PLY94880.1| hypothetical protein LSAT_2X101141 [Lactuca sativa] Length = 86 Score = 66.2 bits (160), Expect = 2e-11 Identities = 40/79 (50%), Positives = 44/79 (55%), Gaps = 2/79 (2%) Frame = -1 Query: 381 MSCKPVPXXXXXXXXXXXXXXFGYEKHXXXXXXXXXXXXXAK--SHLTSLSTDPSMHKGA 208 M+CKP+ FGYE+H S LTSLSTDPS KGA Sbjct: 1 MTCKPLFFLFFLIFFHLLVMSFGYERHTFPTERFQPRRLLKTAASSLTSLSTDPSKLKGA 60 Query: 207 AMNEPQTSVQDSLRKRPPS 151 AMNEPQTSV+DSLRKRPPS Sbjct: 61 AMNEPQTSVEDSLRKRPPS 79