BLASTX nr result
ID: Chrysanthemum22_contig00033069
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00033069 (986 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AER58181.1| copalyl pyrophosphate synthase 1 [Stevia ovata] 59 8e-06 >gb|AER58181.1| copalyl pyrophosphate synthase 1 [Stevia ovata] Length = 774 Score = 58.9 bits (141), Expect = 8e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = -3 Query: 273 QVGWALDVP*YAILPRVAAIYYLEQYGGDDDVW 175 +VG+ALDVP YA LPR+ A YYLEQYGGDDDVW Sbjct: 459 EVGYALDVPWYASLPRLEARYYLEQYGGDDDVW 491