BLASTX nr result
ID: Chrysanthemum22_contig00032988
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032988 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022013637.1| protein STRUBBELIG-RECEPTOR FAMILY 7-like [H... 57 1e-06 >ref|XP_022013637.1| protein STRUBBELIG-RECEPTOR FAMILY 7-like [Helianthus annuus] gb|OTF96725.1| putative STRUBBELIG-receptor family 6 [Helianthus annuus] Length = 701 Score = 57.4 bits (137), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 370 PMSEVVEALVRLVQRTNMSKRTVGNDARSDN 462 PMSEVVEALVRLVQRT+MSKRTVGND R DN Sbjct: 664 PMSEVVEALVRLVQRTDMSKRTVGNDVRHDN 694