BLASTX nr result
ID: Chrysanthemum22_contig00032951
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032951 (389 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005848405.1| hypothetical protein CHLNCDRAFT_51729 [Chlor... 55 6e-06 >ref|XP_005848405.1| hypothetical protein CHLNCDRAFT_51729 [Chlorella variabilis] gb|EFN56303.1| hypothetical protein CHLNCDRAFT_51729 [Chlorella variabilis] Length = 1223 Score = 54.7 bits (130), Expect = 6e-06 Identities = 31/84 (36%), Positives = 40/84 (47%), Gaps = 15/84 (17%) Frame = +3 Query: 75 PSKKR---PG-KNAAGLLY-------CHPCHMRQ-EVALTCLNCELSFCGRALKDKYQLV 218 P KKR PG + G +Y CH C + E C C L FC + L+++YQ Sbjct: 44 PKKKRNNNPGIRVQGGRVYDSENGTTCHQCRQKTAETKAKCARCTLHFCPKCLENRYQER 103 Query: 219 KDPVT---GWPCPRCTGVCDCDRC 281 + V GW CPRC G C+C C Sbjct: 104 VEEVNARPGWSCPRCRGDCNCSNC 127