BLASTX nr result
ID: Chrysanthemum22_contig00032694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032694 (572 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023741146.1| transcription factor MYBC1-like [Lactuca sat... 63 2e-08 gb|KVI12094.1| Homeodomain-like protein [Cynara cardunculus var.... 58 1e-06 >ref|XP_023741146.1| transcription factor MYBC1-like [Lactuca sativa] gb|PLY68178.1| hypothetical protein LSAT_8X82860 [Lactuca sativa] Length = 284 Score = 62.8 bits (151), Expect = 2e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 2 QGVHRVGNPVHGSYVDDLENGKEKKALTLFPVGDD 106 Q +HRVG PVH SY+DDLE+ KEKKALTLFP+GDD Sbjct: 250 QPLHRVGTPVHNSYMDDLESAKEKKALTLFPIGDD 284 >gb|KVI12094.1| Homeodomain-like protein [Cynara cardunculus var. scolymus] Length = 282 Score = 57.8 bits (138), Expect = 1e-06 Identities = 28/39 (71%), Positives = 31/39 (79%), Gaps = 4/39 (10%) Frame = +2 Query: 2 QGVHRVGNPVHGS----YVDDLENGKEKKALTLFPVGDD 106 Q VHRVG PVH S YVDDLE+ +EKKALTLFP+GDD Sbjct: 244 QPVHRVGTPVHNSVSSSYVDDLESAQEKKALTLFPIGDD 282