BLASTX nr result
ID: Chrysanthemum22_contig00032459
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032459 (369 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022011892.1| amino acid permease 4-like [Helianthus annuu... 54 8e-06 >ref|XP_022011892.1| amino acid permease 4-like [Helianthus annuus] gb|OTF95050.1| putative amino acid transporter, transmembrane domain-containing protein [Helianthus annuus] Length = 512 Score = 53.9 bits (128), Expect = 8e-06 Identities = 28/44 (63%), Positives = 31/44 (70%), Gaps = 1/44 (2%) Frame = +2 Query: 113 PDMYLQIFINYSRSFDYDGRLKHTGTYWTA-SHIITAVSWKGKL 241 P + I NYS+SFD DGRLK TGT+WTA SHIITAV G L Sbjct: 38 PTQAINIEANYSKSFDDDGRLKRTGTFWTASSHIITAVIGSGVL 81