BLASTX nr result
ID: Chrysanthemum22_contig00032252
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032252 (521 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021996617.1| rho guanine nucleotide exchange factor 8-lik... 62 7e-08 ref|XP_021990439.1| rho guanine nucleotide exchange factor 8-lik... 60 3e-07 ref|XP_023770021.1| rho guanine nucleotide exchange factor 8-lik... 58 1e-06 >ref|XP_021996617.1| rho guanine nucleotide exchange factor 8-like [Helianthus annuus] Length = 469 Score = 61.6 bits (148), Expect = 7e-08 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -3 Query: 318 ACAFGQQHKLAPMAEDRK*RWRREVGWLLSVIN 220 A AFG+QHKLAPM EDRK RWRREVGWLLSV N Sbjct: 66 ASAFGEQHKLAPMPEDRKRRWRREVGWLLSVTN 98 >ref|XP_021990439.1| rho guanine nucleotide exchange factor 8-like [Helianthus annuus] gb|OTG13196.1| putative PRONE domain-containing protein [Helianthus annuus] Length = 458 Score = 59.7 bits (143), Expect = 3e-07 Identities = 27/31 (87%), Positives = 28/31 (90%) Frame = -3 Query: 318 ACAFGQQHKLAPMAEDRK*RWRREVGWLLSV 226 A AFG+QHKLAPM EDRK RWRREVGWLLSV Sbjct: 69 ASAFGEQHKLAPMPEDRKRRWRREVGWLLSV 99 >ref|XP_023770021.1| rho guanine nucleotide exchange factor 8-like [Lactuca sativa] gb|PLY80702.1| hypothetical protein LSAT_5X103520 [Lactuca sativa] Length = 479 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/31 (83%), Positives = 27/31 (87%) Frame = -3 Query: 318 ACAFGQQHKLAPMAEDRK*RWRREVGWLLSV 226 A FG+QHKLAPM EDRK RWRREVGWLLSV Sbjct: 64 ASVFGEQHKLAPMPEDRKRRWRREVGWLLSV 94