BLASTX nr result
ID: Chrysanthemum22_contig00032169
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032169 (524 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022035460.1| homeobox protein LUMINIDEPENDENS [Helianthus... 56 6e-06 >ref|XP_022035460.1| homeobox protein LUMINIDEPENDENS [Helianthus annuus] gb|OTG29060.1| putative homeodomain-like, Transcription factor IIS [Helianthus annuus] Length = 975 Score = 56.2 bits (134), Expect = 6e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 103 TDDLEKYFTAFIFDLLR*EETFHGQVKLMEWIL 5 TD+ EKYF A IFDLLR EETF GQVKLMEWIL Sbjct: 186 TDESEKYFIAHIFDLLRKEETFSGQVKLMEWIL 218