BLASTX nr result
ID: Chrysanthemum22_contig00032165
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032165 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023733010.1| pentatricopeptide repeat-containing protein ... 60 8e-08 ref|XP_022035295.1| pentatricopeptide repeat-containing protein ... 60 1e-07 >ref|XP_023733010.1| pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Lactuca sativa] gb|PLY74628.1| hypothetical protein LSAT_7X26041 [Lactuca sativa] Length = 580 Score = 60.1 bits (144), Expect = 8e-08 Identities = 26/43 (60%), Positives = 33/43 (76%) Frame = +3 Query: 276 DHLKNQNHNNPFVFSNKLTYPYVYSCTKLIPSYLRNNRFHDAL 404 DHLK+Q N +F NKL+YP VYSCTK+I ++RNNR +DAL Sbjct: 53 DHLKHQRTNEALLFPNKLSYPDVYSCTKMIQGHVRNNRLNDAL 95 >ref|XP_022035295.1| pentatricopeptide repeat-containing protein At5g46460, mitochondrial [Helianthus annuus] gb|OTG28903.1| putative pentatricopeptide repeat (PPR) superfamily protein [Helianthus annuus] Length = 684 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/43 (62%), Positives = 31/43 (72%) Frame = +3 Query: 276 DHLKNQNHNNPFVFSNKLTYPYVYSCTKLIPSYLRNNRFHDAL 404 DHLKN N+ VF NK YP VYSCTK+I SY+RNNR +AL Sbjct: 30 DHLKNLKKNDTLVFPNKFRYPDVYSCTKMIQSYVRNNRLDNAL 72