BLASTX nr result
ID: Chrysanthemum22_contig00032072
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00032072 (565 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PLY85682.1| hypothetical protein LSAT_7X92941 [Lactuca sativa] 59 1e-08 >gb|PLY85682.1| hypothetical protein LSAT_7X92941 [Lactuca sativa] Length = 72 Score = 59.3 bits (142), Expect = 1e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 188 QLFHRSRTMPPLSSNFDSEKRTVPTGPNPLHNKR 289 QLFHRSR+M PL+++ SEKR VPTGPNPLHNKR Sbjct: 39 QLFHRSRSMHPLANDLHSEKRRVPTGPNPLHNKR 72