BLASTX nr result
ID: Chrysanthemum22_contig00031896
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00031896 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022030406.1| uncharacterized protein LOC110931315 [Helian... 56 5e-06 ref|XP_021980198.1| uncharacterized protein LOC110876333 [Helian... 56 5e-06 ref|XP_022032130.1| uncharacterized protein LOC110933204 [Helian... 56 6e-06 gb|OTG20763.1| putative ribonuclease H-like domain, Reverse tran... 56 6e-06 >ref|XP_022030406.1| uncharacterized protein LOC110931315 [Helianthus annuus] Length = 323 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 502 VEFVRGELQRADILTKALARIKFKEMQELLGVEDL 398 VE + GELQRADILTKALAR+KF M+ELLGV+DL Sbjct: 289 VEHISGELQRADILTKALARVKFATMRELLGVQDL 323 >ref|XP_021980198.1| uncharacterized protein LOC110876333 [Helianthus annuus] Length = 355 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 502 VEFVRGELQRADILTKALARIKFKEMQELLGVEDL 398 VE + GELQRADILTKALARIKF M+ELLG++DL Sbjct: 313 VEHISGELQRADILTKALARIKFATMRELLGIQDL 347 >ref|XP_022032130.1| uncharacterized protein LOC110933204 [Helianthus annuus] Length = 578 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 502 VEFVRGELQRADILTKALARIKFKEMQELLGVEDL 398 VE + GELQRADILTKALARIKF M+ELLG++DL Sbjct: 222 VEHISGELQRADILTKALARIKFATMRELLGIQDL 256 >gb|OTG20763.1| putative ribonuclease H-like domain, Reverse transcriptase, RNA-dependent DNA polymerase [Helianthus annuus] Length = 920 Score = 55.8 bits (133), Expect = 6e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -1 Query: 502 VEFVRGELQRADILTKALARIKFKEMQELLGVEDL 398 VE + GELQRADILTKALARIKF M+ELLG++DL Sbjct: 878 VEHISGELQRADILTKALARIKFATMRELLGIQDL 912