BLASTX nr result
ID: Chrysanthemum22_contig00031845
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Chrysanthemum22_contig00031845 (500 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_021985765.1| uncharacterized protein LOC110881949 [Helian... 70 1e-11 >ref|XP_021985765.1| uncharacterized protein LOC110881949 [Helianthus annuus] Length = 202 Score = 70.1 bits (170), Expect = 1e-11 Identities = 31/35 (88%), Positives = 32/35 (91%) Frame = -2 Query: 391 FKRLDDGSLRIQMSCSCAKRFEILHNQIGCFYRLI 287 FKRLDDG+LRIQM CSC KRFEILHN IGCFYRLI Sbjct: 168 FKRLDDGALRIQMRCSCRKRFEILHNHIGCFYRLI 202